KEGG   Bacillus subtilis subsp. subtilis 168: BSU04680
Entry
BSU04680          CDS       T00010                                 

Symbol
rsbS
Name
(RefSeq) RsbT antagonist protein RsbS
  KO
K17762  rsbT antagonist protein RsbS
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU04680 (rsbS)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     BSU04680 (rsbS)
SSDB
Motif
Pfam: STAS STAS_2 NAD_binding_3
Other DBs
NCBI-GeneID: 938157
NCBI-ProteinID: NP_388349
Pasteur: BG11091
BSORF: BG11091
UniProt: P42410 A0A6M4JIP2
Structure
Position
520237..520602
AA seq 121 aa
MRHPKIPILKLYNCLLVSIQWELDDQTALTFQEDLLNKIYETGANGVVIDLTSVDMIDSF
IAKVLGDVITMSKLMGAKVVLTGIQPAVAVTLIELGIALEEIETALDLEQGLETLKRELG
E
NT seq 366 nt   +upstreamnt  +downstreamnt
ttgagacatccgaaaatcccgatcttgaaactgtataattgcttattagtgtccattcag
tgggaacttgatgaccagacagcattaacttttcaagaagacttattaaataaaatatac
gaaacaggtgctaacggagtcgtcattgacctgacatctgtggatatgattgattcattt
atcgcgaaagtgctgggggacgtcattacaatgtctaagttaatgggggctaaagtcgtc
ttgaccggcattcagcccgctgtggcagtgacgctgattgaacttggaatcgcgcttgag
gaaatcgaaactgcgctcgacttagagcaggggcttgagacattgaagcgggaattgggg
gaatag

DBGET integrated database retrieval system