KEGG   Bacillus subtilis subsp. subtilis 168: BSU04700
Entry
BSU04700          CDS       T00010                                 

Symbol
rsbU
Name
(RefSeq) phosphoserine phosphatase RsbU
  KO
K07315  phosphoserine phosphatase RsbU/P [EC:3.1.3.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU04700 (rsbU)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     BSU04700 (rsbU)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     BSU04700 (rsbU)
SSDB
Motif
Pfam: SpoIIE RsbU_N DsrH
Other DBs
NCBI-GeneID: 939939
NCBI-ProteinID: NP_388351
Pasteur: BG11057
BSORF: BG11057
UniProt: P40399 A0A6M4JD91
Structure
Position
521019..522026
AA seq 335 aa
MDFREVIEQRYHQLLSRYIAELTETSLYQAQKFSRKTIEHQIPPEEIISIHRKVLKELYP
SLPEDVFHSLDFLIEVMIGYGMAYQEHQTLRGIQQEIKSEIEIAANVQQTLLGTKVPQEE
ALDIGAISVPAKQMSGDYYHFVKDKESINIAIADVIGKGIPAALCMSMIKYAMDSLPETG
IHPSQVLKNLNRVVEQNVDASMFITMFYANYNMDKHQFTYASAGHEPGFYYSQKDNTFYD
LEAKGLVLGISQDYDYKQFDQHLEKGDMIVLFSDGVTECRTENGFLERPDLQKLIEEHMC
SSAQEMVKNIYDSLLKLQDFQLHDDFTLIVLRRKV
NT seq 1008 nt   +upstreamnt  +downstreamnt
gtggattttagggaggttattgagcagcggtatcatcagctgcttagtcgatatatagcc
gaattaacagaaacatctttatatcaagcccaaaaattcagccgaaaaacaatcgagcac
caaattcctccggaagaaatcatcagcattcacagaaaagtgctgaaggagctgtatcca
agtctcccggaagatgtgtttcattcgctggattttttaatagaagtcatgattggctat
ggaatggcttatcaggagcatcaaacccttagagggatacagcaggaaatcaaatcagaa
attgaaatcgcggcaaatgtccagcagacgcttctcggaactaaagttcctcaggaggaa
gcgctggatatcggcgccatcagtgttcccgctaaacagatgagcggtgattactaccac
tttgtcaaagacaaggaatccatcaatatcgcaatcgcggacgtgatcggaaaaggcatt
ccagcggctttatgcatgtccatgattaaatacgcaatggactctttgccggaaacgggc
atacacccttctcaagtgctgaaaaatttgaatcgtgttgttgaacaaaacgttgatgcc
agtatgtttattacgatgttttatgcgaattacaatatggacaagcatcaatttacatat
gcttcagcgggacatgaaccgggattctattattctcaaaaagacaacacgttttacgat
ttagaggccaaaggactcgttctcggcatctcgcaggactatgactacaaacaattcgat
cagcatctggaaaagggcgatatgattgttttattttctgacggcgtcacagaatgcaga
acggaaaacggtttcttggagcgtcctgatctgcagaagctcattgaggaacatatgtgt
tcctctgcgcaggaaatggtcaaaaacatttatgacagcctcctcaaattgcaggatttt
cagcttcacgatgattttacgttaattgttttgcggagaaaggtttaa

DBGET integrated database retrieval system