KEGG   Bacillus subtilis subsp. subtilis 168: BSU04710
Entry
BSU04710          CDS       T00010                                 

Symbol
rsbV
Name
(RefSeq) anti-sigma-B factor antagonist
  KO
K04749  anti-sigma B factor antagonist
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU04710 (rsbV)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     BSU04710 (rsbV)
SSDB
Motif
Pfam: STAS STAS_2
Other DBs
NCBI-GeneID: 939930
NCBI-ProteinID: NP_388352
Pasteur: BG10733
BSORF: BG10733
UniProt: P17903 A0A6M4JF75
Structure
Position
522088..522417
AA seq 109 aa
MNINVDVKQNENDIQVNIAGEIDVYSAPVLREKLVPLAEQGADLRICLKDVSYMDSTGLG
VFVGTFKMVKKQGGSLKLENLSERLIRLFDITGLKDIIDISAKSEGGVQ
NT seq 330 nt   +upstreamnt  +downstreamnt
atgaatataaatgttgatgtgaagcaaaacgagaatgatatacaagtaaacattgcagga
gaaattgatgtatactcagccccggtgcttagagagaagctcgttcctctggcagaacaa
ggagctgacttaagaatttgcctgaaagatgtcagctacatggacagtaccggattgggc
gtttttgtagggacctttaaaatggtgaaaaaacaaggtggttcgctgaaacttgaaaat
ctttctgaacggctgatccgactgtttgacattacaggcttgaaggacatcattgatatt
tctgcaaagtcagaaggtggagtgcaatga

DBGET integrated database retrieval system