KEGG   Bacillus subtilis subsp. subtilis 168: BSU04720
Entry
BSU04720          CDS       T00010                                 

Symbol
rsbW
Name
(RefSeq) serine-protein kinase RsbW
  KO
K04757  serine/threonine-protein kinase RsbW [EC:2.7.11.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU04720 (rsbW)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU04720 (rsbW)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BSU04720 (rsbW)
Protein kinases [BR:bsu01001]
 Serine/threonine kinases: Other
  Bacterial family
   BSU04720 (rsbW)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     BSU04720 (rsbW)
SSDB
Motif
Pfam: HATPase_c_2 HATPase_c UBA_2
Other DBs
NCBI-GeneID: 938167
NCBI-ProteinID: NP_388353
Pasteur: BG10734
BSORF: BG10734
UniProt: P17904 A0A6M4JFQ5
Position
522414..522896
AA seq 160 aa
MKNNADYIEMKVPAQPEYVGIIRLTLSGVASRMGYTYDEIEDLKIAVSEACTNAVQHAYK
EDKNGEVSIRFGVFEDRLEVIVADEGDSFDFDQKQQDLGPYTPSHTVDQLSEGGLGLYLM
ETLMDEVRVQNHSGVTVAMTKYLNGERVDHDTTIKNYETN
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaagaataatgctgattacatcgaaatgaaagtgccggcccaacctgaatatgtggga
attataagactgacgctgtcaggggtcgcaagcagaatgggctatacgtacgatgaaatt
gaagacttgaaaatcgcagtcagtgaggcgtgcacaaatgcggttcagcacgcttacaaa
gaagataaaaatggggaagtgtcaatacgattcggtgtgtttgaagaccgtttagaggtt
attgtggcggatgaaggagacagctttgactttgatcaaaagcagcaggatctagggccg
tacacaccttcgcacacagttgatcaattatcagaaggagggctcggtctatatttaatg
gaaacgctcatggatgaagtcagagtgcaaaaccactccggcgtcaccgtagcgatgaca
aagtatttaaatggggagcgagttgatcatgacacaaccatcaaaaactacgaaactaac
taa

DBGET integrated database retrieval system