KEGG   Bacillus subtilis subsp. subtilis 168: BSU04740
Entry
BSU04740          CDS       T00010                                 

Symbol
rsbX
Name
(RefSeq) phosphoserine phosphatase RsbX
  KO
K05518  phosphoserine phosphatase RsbX [EC:3.1.3.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU04740 (rsbX)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     BSU04740 (rsbX)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     BSU04740 (rsbX)
SSDB
Motif
Pfam: SpoIIE PP2C_2
Other DBs
NCBI-GeneID: 938155
NCBI-ProteinID: NP_388355
Pasteur: BG10736
BSORF: BG10736
UniProt: P17906 A0A6M3Z7Q0
Structure
PDB: 

Position
523650..524249
AA seq 199 aa
MIQVEENEHIQTLVYQLNKEGKSICGDSFFMKADDKELICAVADGLGSGSLANESSAAIK
DLVENYASEDVESIIERCNQAMKNKRGATASILKINFEQRQFTYCSVGNVRFILHSPSGE
SFYPLPISGYLSGKPQKYKTHTATYEKGSKFIIHTDGLNVPDIRSHLKKGQSVEEISNSL
KMYTTSRKDDLTYILGQLS
NT seq 600 nt   +upstreamnt  +downstreamnt
atgatccaggttgaagaaaacgagcatattcaaactctagtatatcaactgaataaagaa
gggaaatcgatttgcggtgacagtttttttatgaaagctgatgataaggagttaatttgc
gcggttgctgacggactgggaagtggatcacttgctaacgaatcctctgcagccatcaaa
gacttagtggaaaactatgcgagtgaagacgtagaaagcattatcgaacgctgtaatcag
gcgatgaaaaacaaaagaggcgctacagcatctatcctgaaaatcaattttgagcaaagg
cagtttacgtactgctctgtcggaaatgtacggtttattctgcattccccgtctggtgaa
agcttttatcctctgccgatttcgggctatttatcaggcaagccgcaaaaatacaaaacg
cacaccgccacctatgaaaagggttcaaagttcattatacatacagatggactcaacgta
cctgatatccgctcccatttgaaaaaaggccaatcggtagaagaaatatcgaattcgctg
aaaatgtatacgacatcgagaaaagatgacctgacctatattctcggacagctgtcctaa

DBGET integrated database retrieval system