KEGG   Bacillus subtilis subsp. subtilis 168: BSU04750
Entry
BSU04750          CDS       T00010                                 

Gene name
ydcF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938158
NCBI-ProteinID: NP_388356
Pasteur: BG12093
BSORF: BG12093
UniProt: P96623 A0A6M3ZAX2
Position
524492..524785
AA seq 97 aa
MERKEHCFCKEKQFSYGLSMWRNIGRFLSWSTCPHSNVIMEFFHVLQKQKEDLCITYGIV
LEGAEAKKWGEIIGTELSKDMPTAVSRLVHLYGGVIK
NT seq 294 nt   +upstreamnt  +downstreamnt
atggaacggaaggaacattgcttctgcaaggaaaaacaattctcttatggcttgagcatg
tggagaaacatcgggcgttttctgtcatggtcaacatgcccgcatagcaatgtaataatg
gagttttttcacgtgcttcaaaagcaaaaagaagatttgtgtatcacatatggaattgta
ttagaaggcgctgaagcaaaaaagtggggagaaatcattgggactgaactgtctaaagac
atgccgacggctgtcagcaggcttgtccatctttacggaggagtgataaaatga

DBGET integrated database retrieval system