KEGG   Bacillus subtilis subsp. subtilis 168: BSU04760
Entry
BSU04760          CDS       T00010                                 

Symbol
ydcG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: EVE
Other DBs
NCBI-GeneID: 938162
NCBI-ProteinID: NP_388357
Pasteur: BG12094
BSORF: BG12094
UniProt: P96624 A0A6M3Z7W6
Position
524782..525222
AA seq 146 aa
MNTNYWIGVVSEQHVLKGAAGGFAQLCHGKKAPLAKMKEGDWLIYYSPRDAYPDGKLLRS
FTAIGKVKSGNIYPYQMAPNFIPYRLDIDYYPCHKIGFYDIKSKLEFVQETKHLGFLFRR
GHFEISKKDFLTIAQAMGVNISGMAL
NT seq 441 nt   +upstreamnt  +downstreamnt
atgaacacaaattactggatcggcgttgtgtcagagcaacatgtattaaaaggcgctgcc
ggcggttttgcacagctgtgccatggaaaaaaagccccgctcgccaaaatgaaagaggga
gattggctgatttattattctccgagagacgcatatccagacggcaaactgctgcgaagc
tttactgcgatcggcaaagtaaaaagcggaaacatctatccgtatcaaatggctccgaat
tttattccataccgattagatatagactattatccatgccataaaatcggtttttacgac
attaaatcaaagcttgaatttgttcaggaaaccaagcatcttggctttttatttcgcaga
ggacactttgaaataagcaaaaaagattttttgacaatagcacaagcgatgggagttaac
ataagtggaatggcactctaa

DBGET integrated database retrieval system