KEGG   Bacillus subtilis subsp. subtilis 168: BSU04770
Entry
BSU04770          CDS       T00010                                 

Symbol
ydcH
Name
(RefSeq) MarR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MarR HTH_27 MarR_2 HTH_34 HxlR HTH_Crp_2 TrmB Rio2_N HTH_15 GntR Rrf2 Sigma54_CBD
Other DBs
NCBI-GeneID: 939928
NCBI-ProteinID: NP_388358
Pasteur: BG12095
BSORF: BG12095
UniProt: P96625
Position
525206..525649
AA seq 147 aa
MEWHSKFSGPNTSPGFLLWQATQSWQRKVGKALAEFDLTHVQFVLLTSCKYMIAHGETVT
QKKLASFSQTNIMMVSEVVRTLEKKGFIERSKNPQDKREVLLSLTEIGGEKVTAALPIVE
KIDQAFFAAAMKKENFLSGLQELLKHE
NT seq 444 nt   +upstreamnt  +downstreamnt
gtggaatggcactctaaatttagcggtccgaacacaagcccgggctttttattatggcag
gccacgcaaagttggcagcggaaagtaggaaaagcattggctgagtttgacctgacccac
gttcaatttgttctgctgacctcgtgcaagtatatgattgctcacggagaaaccgtcacg
caaaaaaaacttgcaagcttcagccagaccaatatcatgatggtttcggaggttgtgcgg
acgcttgagaaaaaaggatttatcgaaagaagcaaaaatccccaggataaaagagaggtc
ctcctgtctcttacagaaataggaggagaaaaagtaacagcggctttgccaattgttgag
aagattgatcaagccttctttgcagctgcgatgaaaaaagagaattttctgagcggctta
caggaactattgaaacatgagtaa

DBGET integrated database retrieval system