KEGG   Bacillus subtilis subsp. subtilis 168: BSU04780
Entry
BSU04780          CDS       T00010                                 

Symbol
ydcI
Name
(RefSeq) hypothetical protein
  KO
K06959  protein Tex
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    BSU04780 (ydcI)
SSDB
Motif
Pfam: Tex_N Tex_YqgF HHH_3 HHH_9 S1 YqgF HHH_7 T2SSK RWP-RK
Other DBs
NCBI-GeneID: 939932
NCBI-ProteinID: NP_388359
Pasteur: BG12096
BSORF: BG12096
UniProt: O31489 A0A6M4JD43
Position
525743..527902
AA seq 719 aa
METSALLKQQIAKEIGLSQKHVESVIRLLEDGNTVPFIARYRKEQTGSMDEVQIQTISER
WQYIQNLNQRKEEVIRLIAEQDKLTDNLKRKIEQSVKLQEVEDLYRPYKQKRKTKATVAK
SKGLEPLADYILTLPQDDHLAATADQYISEEKEVFTREEAIEGAKHIIAEQISDEPTFRK
WIRQETFKRGTIKSAAGKSADTDEKNVYEMYYEYEEPIAKVVPHRVLAMNRGEKEDILKV
AIEPPADHIKAYLEKQIIKNRSTSVREILQETIEDSYKRLIQPAIEREIRKELSEKADEQ
AIHIFSENLRKLLLQPPMKGKTVLGVDPAFRTGCKLAVSDETGKVLKIDVIYPHAPVNKT
KEAHEKVKKILEQYQVEMVAIGNGTASRETEQFIVNVLRDMPRKIYYVIVNEAGASVYSA
SELAREEFPDLKVEERSAVSIARRLQDPLAELVKIDPKSVGVGQYQHDVSQKRLNESLRF
VVETVVNQVGVNVNTASAALLQYVAGLSKSVAGNVVKKREEIGKFSNRKELKDIPRLGAK
TYEQCIGFLRVQEGTEPLDRTGIHPESYKETKALLKKLGLSTEHIGTAELKDKINQLALS
ETAKELGIGEITLKDICEQLTRPERDPRDKVPKPLLKTDVLQLEDLKEGMELQGTVRNVV
DFGAFVDIGVKQDGLVHISKLSNQFVKHPLDVVSVGDIVTVWVDGVDVQKGRVSLSMVK
NT seq 2160 nt   +upstreamnt  +downstreamnt
atggaaacgtcagcccttttaaaacagcaaattgcgaaagaaataggtttatcacaaaaa
cacgttgaaagtgtcatccgcctgcttgaggacggcaatacagtcccgtttattgcccgg
tatcgaaaagagcagacgggttcaatggatgaggttcagattcagacgatttctgaacgc
tggcaatacatacaaaacctgaatcagcgaaaagaagaagtcatcaggctgattgcagag
caggataaactgacagataatctaaaacgtaaaatcgagcaatcggtgaagcttcaggaa
gtggaagacctttaccgcccttataaacaaaaacgtaaaacaaaggcgacagtcgccaaa
agcaaaggccttgagccgcttgccgactatatcctgacacttccccaagatgatcatctg
gcagcaactgcagaccaatacatcagcgaagaaaaagaagtgttcacacgagaagaagcg
attgaaggcgccaagcacattattgcggaacaaatctcagacgagccgaccttcagaaag
tggattcgccaggaaaccttcaaaagaggaaccattaagtctgcagccggaaagtcggca
gacaccgatgagaaaaatgtgtatgaaatgtattacgagtatgaagagccaattgcaaaa
gttgttccgcatagggtgctggcaatgaaccgcggcgaaaaagaagacattttaaaggta
gcgatcgaaccgcctgcggatcacattaaggcgtatttagaaaaacaaatcatcaaaaat
cgctcaacatccgtaagagagattttgcaggagacaattgaagacagctataaaaggctg
atccagccggcaatcgagcgtgaaatcaggaaagagctctcagaaaaagctgatgaacag
gcgattcatattttctcagagaacttgagaaagcttcttttgcagccgccgatgaaaggc
aaaaccgttctcggtgttgacccagcctttcgaactggctgtaagctcgctgtgtcagat
gagaccggaaaagtcttgaaaattgatgtgatctatccgcatgcgccagtcaacaaaaca
aaagaagcccatgaaaaagtgaaaaagattcttgagcagtatcaagtcgagatggtggcg
atcggaaacggcacagcatccagagaaacagagcaattcatcgtcaatgtactcagagac
atgccgcgcaaaatttattatgtgatcgtcaatgaagcgggagcaagcgtctattcggct
tcagagcttgccagagaagaattccctgaccttaaggttgaagagcgcagtgccgtatct
attgctcggagacttcaagacccgctcgcggagctcgttaagatcgatccgaagtctgtt
ggtgtcggacagtatcagcatgacgtcagccaaaaacgcttaaatgaatctctgcggttt
gtcgtcgaaactgtcgtaaaccaggttggagtaaacgtcaacacagcctccgccgcgctg
cttcaatatgtagctggattatcgaagtctgtagcaggcaacgttgtcaaaaaacgtgag
gaaatcggaaagttttcaaatcgaaaagaactgaaggacatcccaaggttaggtgcgaaa
acctatgagcaatgtatcggtttcttaagagtgcaggaagggacagagcctttggataga
acaggcatccacccggaaagctataaagaaacaaaagcacttttgaaaaaactcggactt
tcaacagaacatatcggcacggcggaattgaaggacaaaatcaatcagctggcgctctct
gaaacggcaaaagagctgggaatcggcgaaatcactctgaaagacatttgtgaacagctg
acaaggccggaacgcgatccacgcgataaggtgcctaagcctttgctgaaaacagacgtc
cttcagctggaagatttgaaagagggaatggaactgcagggcaccgtgcgcaatgtagtg
gacttcggagcgtttgttgatatcggagtcaaacaagacgggcttgtgcatatctcaaaa
ttgagcaatcaattcgtcaagcatcctcttgatgtcgtatctgtcggcgatattgtgaca
gtttgggttgacggcgtagatgtacaaaaaggcagagtatcgctgtctatggtaaaataa

DBGET integrated database retrieval system