KEGG   Bacillus subtilis subsp. subtilis 168: BSU04790
Entry
BSU04790          CDS       T00010                                 

Symbol
ydcK
Name
(RefSeq) protein SprT-like
  KO
K03095  SprT-like protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU04790 (ydcK)
SSDB
Motif
Pfam: SprT-like Zn_ribbon_SprT Zn-ribbon_8 DUF5816 DUF3362 TFIIS_C NCD3G
Other DBs
NCBI-GeneID: 938154
NCBI-ProteinID: NP_388360
Pasteur: BG12098
BSORF: BG12098
UniProt: P96628 A0A6M3Z860
Position
528129..528581
AA seq 150 aa
MDNKELQKLTEDISETYFKKPFRHQALFNDRLKTTGGRYLLTSHNIELNRKYLIEHGREE
LIGIIKHELCHYHLHLEGKGYKHRDRDFRMLLQQVNAPRFCTPLKKKAENKKTYMYICTT
CGQQYIKKRAMNPDRYRCGKCRGKIKRIFS
NT seq 453 nt   +upstreamnt  +downstreamnt
atggataacaaagagcttcaaaagctgacagaggatatttctgaaacatattttaaaaag
ccgttccgccatcaggcgctttttaatgaccggcttaaaaccactggcggcaggtacctg
ttaacctcccataacattgaattgaacagaaaatatttgattgaacacggcagggaggaa
ctgattggcatcatcaagcacgagctctgccattatcatcttcatcttgaaggaaaaggg
tacaagcacagagacagagattttagaatgctattgcagcaggtcaacgcgccgaggttc
tgtacaccccttaagaaaaaagcggaaaacaaaaaaacttatatgtatatctgtacgacc
tgcggccaacagtatataaagaagcgcgccatgaaccctgacagatacagatgcggaaaa
tgccgcggaaaaataaaaagaattttttcgtga

DBGET integrated database retrieval system