KEGG   Bacillus subtilis subsp. subtilis 168: BSU04800
Entry
BSU04800          CDS       T00010                                 

Symbol
ydcL
Name
(RefSeq) ICEBs1 integrase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Phage_integrase Phage_int_SAM_3 Phage_int_SAM_5 Phage_int_SAM_4 Phage_int_SAM_1 Arm-DNA-bind_4 FAA_hydro_N_2 Acetyltransf_2 Phage_int_SAM_2
Other DBs
NCBI-GeneID: 938151
NCBI-ProteinID: NP_388361
Pasteur: BG12099
BSORF: BG12099
UniProt: P96629 A0A6M4JFR2
Position
complement(529505..530611)
AA seq 368 aa
MSVKKLENGQYQVDVSFGFDPITGERIRTRPVASTRKEALELEAKLRREFQEERARKSRS
VSFPTLISIYLASCEIDSKPNYYQNQKYIINKHISDYFLKSDIQKITHREITDFRKHLME
TGLSNKSVNNIMTSLSKIFDTAVHEEILKRNPCDNVKRLPLTRKKMKFWRPEEFKKFISL
IPQDQLLFKTFYTVAFLTGLRCGEMLALQWKDIDKILLEIDVHKSCTWLDGQFVVTTPKT
KNSIRRVSINKKLLKLLERWKEAQEELFNELGIRHSHDTYIFQYKDTPSRKDIFSRKIKY
FCKDSDLTPIRLHDFRHSHVALLIHQGEDYITIKERLGHGSVKTTIDVYGHLYPNKQKEM
ADKLDDLL
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgtctgtaaaaaaacttgaaaatggtcaatatcaagttgacgttagctttggatttgac
ccgattactggagaaagaattaggacgagaccagtagcatcaaccagaaaagaggcttta
gaattagaagcaaaattaagaagagaatttcaagaagaaagagcaagaaagtccagatca
gtaagctttccgactctaatttcaatttatttagcaagttgtgaaatagatagtaaacca
aactattatcagaatcagaagtacattataaacaaacatatatctgattactttttgaaa
tctgatatacaaaaaatcacacatagagaaataactgatttcagaaaacatttaatggaa
acaggtctaagcaataaatcggttaataatataatgactagtctaagcaaaatttttgat
acagctgtacatgaagaaatcttaaaaagaaatccgtgtgacaacgttaaacgattacct
ttaacaagaaagaaaatgaagttttggagaccagaagaattcaaaaaatttattagttta
attcctcaagatcaattattgtttaaaaccttttacactgttgcttttttaactggacta
agatgtggtgaaatgctcgccctgcaatggaaagatattgacaaaatcttattagaaata
gatgtgcataaatcgtgcacctggcttgatggtcaatttgttgttactactccaaaaact
aaaaattcgattcggcgagttagcatcaataaaaaattgcttaagctactagaacgttgg
aaagaagcacaagaagagttgtttaatgaattaggtattagacattcacatgatacctat
atctttcaatataaagatacaccttcaagaaaagatattttcagtcggaaaattaaatac
ttttgcaaggatagcgatcttactcctatacgtttacatgattttagacattcacacgtt
gcactattaatacaccaaggagaagattacataacaattaaagagcgtttaggacatggt
tctgtaaaaacaacaattgatgtttatggacacctatatccaaacaagcaaaaggaaatg
gctgataaattagatgacttactttag

DBGET integrated database retrieval system