KEGG   Bacillus subtilis subsp. subtilis 168: BSU04810
Entry
BSU04810          CDS       T00010                                 

Symbol
immA
Name
(RefSeq) metallopeptidase ImmA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peptidase_M78 Tfb5 YafO_toxin
Other DBs
NCBI-GeneID: 939924
NCBI-ProteinID: NP_388362
Pasteur: BG12100
BSORF: BG12100
UniProt: P96630 A0A6M3Z7N1
Position
complement(530624..531133)
AA seq 169 aa
MITIYTSKGIKHKVQSVIKTHGTNNVYEICDIQKIYILKNDLGQANGLLQHDKATDQYLI
HINENLQHQQFVIAHELGHYFLHKRLNTFKVVNCSKVLKDKLEHQASLFASELILTDKML
NEALPYIQGFSKEQIAAYFNVPSFVTDYKLSQIGSFSNRIYSHEISAFG
NT seq 510 nt   +upstreamnt  +downstreamnt
gtgataacaatttatacaagcaaaggaattaaacataaagtgcaatcagtaattaagaca
catggtacaaataatgtctatgaaatttgtgacatccaaaaaatttatatactcaaaaat
gatcttggacaagcaaacggtttactacaacatgacaaagccacagatcaatatttaatc
catatcaacgagaacctccaacatcaacaatttgtaattgcccatgaattagggcattac
tttctccataaaagattgaacacttttaaagttgtgaattgctctaaagttctaaaagat
aaacttgagcatcaagcaagcctatttgcatcagaattaatactgacagataaaatgctt
aatgaagcccttccatatatacagggttttagcaaagaacaaatagcagcatacttcaac
gtaccatcatttgttactgattataaactttctcaaattggctcatttagtaacagaatc
tattcacacgaaataagcgcttttggttaa

DBGET integrated database retrieval system