KEGG   Bacillus subtilis subsp. subtilis 168: BSU04830
Entry
BSU04830          CDS       T00010                                 

Symbol
sacV
Name
(RefSeq) excisionase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TrmB Arg_repressor
Other DBs
NCBI-GeneID: 939938
NCBI-ProteinID: NP_388364
Pasteur: BG12670
BSORF: BG12670
UniProt: O31490 A0A6M4JGM4
Position
531787..531981
AA seq 64 aa
MKGEFLTARDIQKILGVKQAKSYDIIRTLNAQMKEEGYMVIQGKVSRAKFEECYCYKGPK
SQTG
NT seq 195 nt   +upstreamnt  +downstreamnt
ttgaaaggagagtttttaactgcgagagatattcaaaaaattcttggagttaaacaggct
aaatcttatgacatcattagaactttgaatgctcaaatgaaagaagaaggatatatggtc
attcaaggtaaggtgagtagagctaagtttgaagagtgttattgttacaaaggcccaaaa
tctcaaacggggtga

DBGET integrated database retrieval system