KEGG   Bacillus subtilis subsp. subtilis 168: BSU04839
Entry
BSU04839          CDS       T00010                                 

Symbol
ydzL
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_7 HTH_28 HTH_23 DUF433 Trp_repressor
Other DBs
NCBI-GeneID: 8303154
NCBI-ProteinID: YP_003097681
UniProt: C0H3V5 A0A6M3ZIE5
Position
531978..532238
AA seq 86 aa
MIFINIDITNSFMKEAVPLARQMEGDWIARMKIALNSVIINHYLNLPLTIENVNELLRKG
VSYRRICKHYGIGRKDIEKLRQSSVV
NT seq 261 nt   +upstreamnt  +downstreamnt
gtgatttttataaacattgatataacaaactcgtttatgaaagaagctgtccctttagct
agacaaatggaaggtgattggatagcacgaatgaaaattgctctgaattcagtcattata
aatcattatttaaaccttcccttaacaattgaaaatgttaatgaattactgcgaaaaggc
gtttcatatcgcaggatatgtaagcattacggcattggaagaaaagacattgaaaagctt
cggcaatcatccgtagtgtga

DBGET integrated database retrieval system