KEGG   Bacillus subtilis subsp. subtilis 168: BSU04840
Entry
BSU04840          CDS       T00010                                 

Symbol
ydcO
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Lactamase_B_5
Other DBs
NCBI-GeneID: 938142
NCBI-ProteinID: NP_388365
Pasteur: BG12102
BSORF: BG12102
UniProt: P96632 A0A6M4JDK4
Position
532292..532552
AA seq 86 aa
MKIRVNATIITDVEALKADKDLNHFKDYATCETFVVDADNHLKANEEISELLKGWDWWCI
WSTRPLSKKDNQVFTLYNDDLYNLCR
NT seq 261 nt   +upstreamnt  +downstreamnt
atgaaaataagagtgaatgcaacaatcattactgatgttgaagctttaaaggctgataag
gatttgaatcattttaaagactatgccacttgtgaaacattcgttgttgatgctgataat
catttgaaggctaatgaagaaatatctgagttgttaaaaggctgggattggtggtgtatc
tggtcaactcgtccattgagtaaaaaggataaccaagtgtttactttgtataacgatgat
ttgtataacttatgtcgatag

DBGET integrated database retrieval system