KEGG   Bacillus subtilis subsp. subtilis 168: BSU04850
Entry
BSU04850          CDS       T00010                                 

Symbol
ydcP
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF961 Cys_Met_Meta_PP
Other DBs
NCBI-GeneID: 939920
NCBI-ProteinID: NP_388366
Pasteur: BG12103
BSORF: BG12103
UniProt: P96633 A0A6M3Z7X4
Position
532922..533302
AA seq 126 aa
MNLNFIVPDINMTFGDMKFMGLNRERYVYDRENNKRTDVLESRIYNIASAVQGGQIEVTI
PEYAGAKEIPPFADIELKNPKISAMATSQRDSTYANVMWKLEADDIVVKGGSSVKPAAAT
GGNEKK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgaacttaaactttattgtaccggatatcaatatgacttttggagacatgaaattcatg
ggacttaacagagaaaggtatgtttatgatcgtgaaaataataagcgtactgacgtactg
gaatctaggatttataacattgctagtgctgtccaaggtggtcaaattgaagtaactatt
cctgagtatgctggggcaaaagaaattcctccttttgcagatattgagttgaaaaatcca
aaaattagcgctatggcgactagtcaaagggattcgacgtatgccaatgtgatgtggaaa
cttgaagctgatgatattgttgttaaaggtggctcttctgtgaaacctgccgcggcaact
ggcgggaatgaaaagaaataa

DBGET integrated database retrieval system