KEGG   Bacillus subtilis subsp. subtilis 168: BSU04870
Entry
BSU04870          CDS       T00010                                 

Symbol
ydcR
Name
(RefSeq) DNA relaxase NicK
  KO
K07467  putative DNA relaxase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    BSU04870 (ydcR)
SSDB
Motif
Pfam: Rep_trans Rol_Rep_N Phage_CRI
Other DBs
NCBI-GeneID: 939922
NCBI-ProteinID: NP_388368
Pasteur: BG12105
BSORF: BG12105
UniProt: P96635 A0A6M3Z8A8
Position
534773..535831
AA seq 352 aa
MDELKQPPHANRGVVIVKEKNEAVESPLVSMVDYIRVSFKTHDVDRIIEEVLHLSKDFMT
EKQSGFYGYVGTYELDYIKVFYSAPDDNRGVLIEMSGQGCRQFESFLECRKKTWYDFFQD
CMQQGGSFTRFDLAIDDKKTYFSIPELLKKAQKGECISRFRKSDFNGSFDLSDGITGGTT
IYFGSKKSEAYLCFYEKNYEQAEKYNIPLEELGDWNRYELRLKNERAQVAIDALLKTKDL
TLIAMQIINNYVRFVDADENITREHWKTSLFWSDFIGDVGRLPLYVKPQKDFYQKSRNWL
RNSCAPTMKMVLEADEHLGKTDLSDMIAEAELADKHKKMLDVYMADVADMVV
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggatgagctaaaacaacccccccacgctaacaggggggtagtaatcgtaaaagaaaaa
aatgaagccgttgaaagtcctttggtatcaatggttgactatattcgagtctcttttaaa
actcatgatgttgacagaattattgaagaggttcttcaccttagcaaagactttatgact
gagaaacaatctggtttctatggctacgttggcacgtatgaactggactatatcaaagtc
ttttattctgcgccggatgacaacagaggtgttttgatagaaatgtccggtcaaggttgc
cgtcaatttgaatccttcttggaatgccggaagaaaacatggtacgacttctttcaagat
tgcatgcaacaaggcggttcgttcactcgctttgatttagctattgatgataaaaagaca
tacttttctataccagaactgttaaagaaagcccaaaagggcgaatgtatttcacgattt
agaaaatctgatttcaatggctcctttgatctatctgatggcattacaggcgggacgaca
atatatttcggttctaaaaagtcagaagcgtacctttgcttttatgagaaaaactatgaa
caagcagaaaagtataacattccgttagaagaactaggcgattggaatcgttatgaattg
cggcttaaaaatgaacgtgcacaagtggcgatagatgctttattgaaaacaaaggattta
accttaatcgctatgcagatcattaataactatgtaaggttcgttgatgctgatgaaaac
atcactagagagcattggaaaacgagccttttttggtctgattttataggcgatgttggg
agacttcctttgtacgtcaaaccacaaaaagacttctatcagaaatcaagaaactggctt
cgtaactcttgtgctcccactatgaaaatggtgcttgaagctgatgaacatttagggaaa
accgatctgtcagatatgattgcagaagctgaactggctgacaaacataaaaaaatgtta
gatgtgtatatggctgatgttgctgacatggtcgtttaa

DBGET integrated database retrieval system