KEGG   Bacillus subtilis subsp. subtilis 168: BSU04890
Entry
BSU04890          CDS       T00010                                 

Symbol
ydcT
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF6033
Other DBs
NCBI-GeneID: 938146
NCBI-ProteinID: NP_388370
Pasteur: BG12107
BSORF: BG12107
UniProt: P96637 A0A6M4JFS3
Position
536404..536670
AA seq 88 aa
MFNINLLNQARLESDLDSLGCLDIAEELIEKMMEDVFYSDVAQRIIVQTLAVINNANAKL
QATFNILEDEDMETDERSVEFEGISYYE
NT seq 267 nt   +upstreamnt  +downstreamnt
gtgtttaatattaatctgttgaatcaggcccgacttgagagtgatttggattcccttggg
tgtttggatattgctgaggaactgattgaaaaaatgatggaagatgttttttacagtgat
gtagctcaaagaatcattgttcaaacacttgctgttataaataacgccaatgcaaaactt
caagctacgtttaacatcttagaagatgaagatatggagacagacgaacgaagcgtggag
tttgaaggaattagctactacgaataa

DBGET integrated database retrieval system