KEGG   Bacillus subtilis subsp. subtilis 168: BSU04900
Entry
BSU04900          CDS       T00010                                 

Symbol
yddA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938135
NCBI-ProteinID: NP_388371
Pasteur: BG12108
BSORF: BG12108
UniProt: P96638 A0A6M3Z7N8
Position
536687..536995
AA seq 102 aa
MSAVDKRFKSLGFNVGIPSLVFVRSLSRDCMLVVEGERVKGFAEYRYTFYKTRYLPDGRM
TSLKVYMENQSIKRVLHRVASFLSFLERTKQIEQKECEKVAQ
NT seq 309 nt   +upstreamnt  +downstreamnt
gtgtctgctgtagataaacgattcaaaagcttaggttttaatgtgggcattccctcttta
gtttttgtgagaagtttaagcagagattgcatgttggttgttgaaggagaacgagtaaaa
ggatttgctgagtatcgttacacattctataaaacaagatacttgccagacggtcgaatg
actagcttaaaagtttatatggagaatcaaagcataaaaagggtgttacatcgtgtagca
tcctttttatctttcttggaaagaacgaaacaaattgaacagaaggagtgtgaaaaagtt
gctcaataa

DBGET integrated database retrieval system