KEGG   Bacillus subtilis subsp. subtilis 168: BSU04910
Entry
BSU04910          CDS       T00010                                 

Symbol
yddB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TpcC DUF2721 US6
Other DBs
NCBI-GeneID: 939918
NCBI-ProteinID: NP_388372
Pasteur: BG12109
BSORF: BG12109
UniProt: O31491 A0A6M3Z7T7
Position
536985..538049
AA seq 354 aa
MLNKEIGSDKKEESFFRSAFQKLKRIERPEKDKQKVPRDRSKLIAVTLWSCVGSLLFICL
LAVLLSINTRSQLNDMKDETNKPTNDDKQKISVTAAENFLSGFINEYMNVKNDQESIEKR
MQSLESYMVKQEDNHFEDEERFNVDGLKGDRELKGYSLYNVKEGDKNSLFQYKVTYENLY
PVEKEVEKEVKDGKKKKKVKEKVKTNEKYEKQMLLNIPVTNKGDSFAVSAVPYFTQIYDL
KGDIAFKGKEETRDEYAGEKKESIESFLQNFFEKYASEKKEEMVYMMKKPEALEGNLLFG
EVQSVKIFETKKGFEVFCAVRFKEKENDIPVNEKFSLEITENSGQFYVNKLKHQ
NT seq 1065 nt   +upstreamnt  +downstreamnt
ttgctcaataaagaaattggctctgataagaaggaagaatccttttttcggtctgctttt
caaaaactgaaacgaattgaaagaccggaaaaagacaaacaaaaagtaccccgtgacagg
tcaaagctgatagccgtcacactatggtcttgtgtagggagcttgctatttatctgtctg
cttgctgtgcttctgtcaattaatactcgctcccaacttaatgacatgaaagacgaaacg
aataagccaacaaatgacgataaacaaaaaatttcggtgactgctgccgaaaactttctg
tcagggttcatcaatgaatatatgaatgtgaagaacgatcaagaatctattgaaaaacgt
atgcagagccttgaaagctatatggttaaacaggaagataaccattttgaagatgaagaa
cgcttcaatgtggatggtttaaaaggtgatcgagagttaaagggttacagcttatataac
gtgaaagaaggtgataaaaacagcctttttcaatataaggtcacatatgaaaatctatac
cctgtagaaaaggaagttgaaaaagaagttaaagacggaaagaagaaaaagaaggtgaaa
gaaaaggttaaaacaaacgagaaatacgaaaaacaaatgttgctgaatattccagtcaca
aataaaggtgattcctttgcggtgtctgctgtcccttattttacacagatttatgatctg
aaaggcgatattgcttttaagggtaaagaagaaactagagacgaatatgcaggcgagaaa
aaagaatctatcgaatcatttcttcaaaatttctttgagaaatacgcttctgaaaagaaa
gaagaaatggtttatatgatgaaaaagccggaagcattggaaggaaacttgttatttggg
gaagtgcagtcagtgaaaatcttcgagacgaaaaaaggtttcgaggttttttgtgctgtt
cgatttaaggaaaaagaaaatgacattccggtaaatgaaaaattcagtctagagattacg
gaaaacagcggtcagttttatgtaaataaactcaaacatcaatag

DBGET integrated database retrieval system