KEGG   Bacillus subtilis subsp. subtilis 168: BSU04920
Entry
BSU04920          CDS       T00010                                 

Symbol
yddC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938144
NCBI-ProteinID: NP_388373
Pasteur: BG12110
BSORF: BG12110
UniProt: P96640 A0A6M4JGM9
Position
538061..538309
AA seq 82 aa
MDFMNFFILGADLPTLGGVKGWASDVVIQFITIVVMFIAAKNLMKLKMGGIIFVCCIGSA
VTWVIKHWSEFSGWINALMEKL
NT seq 249 nt   +upstreamnt  +downstreamnt
atggatttcatgaatttctttattcttggcgcagaccttccaacacttggaggggtaaaa
ggttgggcatcagatgttgttatccaattcattacgattgtggtcatgttcatagccgca
aagaatctgatgaaattaaaaatgggcggcattatctttgtttgctgtattggcagtgcg
gtaacgtgggttattaaacactggtcagaattctccggctggatcaatgcgctaatggaa
aaattgtaa

DBGET integrated database retrieval system