KEGG   Bacillus subtilis subsp. subtilis 168: BSU04930
Entry
BSU04930          CDS       T00010                                 

Symbol
yddD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TcpE
Other DBs
NCBI-GeneID: 939921
NCBI-ProteinID: NP_388374
Pasteur: BG12111
BSORF: BG12111
UniProt: P96641 A0A6M4JDL1
Position
538322..538846
AA seq 174 aa
MGRLVFNYRKAMREPKKIQQLTENYSLPFAVELIPAINYFIFVGLCFGFWYGVRMIFPHA
FDNSYVIVIFGIPFFLTMLVTKIKPEGKNIYIYFFDFAKYYFFIKLPQKKYCNDRKIDLS
NEKQIEFRKLVKVVDYSNETKNAYEGNTQEFAVNKNGRRVGVLPNKKQFDSYAK
NT seq 525 nt   +upstreamnt  +downstreamnt
atggggcgtctggtgttcaactaccggaaggcaatgagagagccgaaaaaaatccaacaa
ttaaccgaaaattattcgttaccctttgcagttgagttaataccggctattaactatttc
atttttgttggcttatgctttggattctggtacggcgtgaggatgattttccctcacgct
tttgataacagttacgtcattgtgatttttgggataccattttttttaacgatgcttgta
acgaaaataaagccggaaggcaaaaacatctatatatatttctttgatttcgcaaagtat
tacttcttcatcaagcttccacaaaagaagtattgcaatgatcgaaagattgatttaagt
aacgaaaaacaaattgagtttcgaaaacttgtgaaggtggtggattattcaaatgagact
aaaaacgcctatgaaggcaatacacaagaatttgctgttaacaagaacgggcgacgtgtg
ggcgtactaccgaataaaaagcaattcgattcctatgcaaaataa

DBGET integrated database retrieval system