KEGG   Bacillus subtilis subsp. subtilis 168: BSU04950
Entry
BSU04950          CDS       T00010                                 

Symbol
yddF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: STIV_B116-like Cbl_N3 DUF6475
Other DBs
NCBI-GeneID: 938143
NCBI-ProteinID: NP_388376
Pasteur: BG12113
BSORF: BG12113
UniProt: P96643 A0A6M3Z7Y3
Position
541248..541574
AA seq 108 aa
MEIAFLNSLVVTSPGFYKAEKITLDEVKQWLKHYDGRYKSFIGHKSTAQFLQKLLGIRIE
QNRKTFRHMKYQKAICFSLYERYPENVLLTQRDLEKARYQFYLLTRLD
NT seq 327 nt   +upstreamnt  +downstreamnt
atggaaatagctttcttaaactctcttgttgtcacgagtccaggcttttataaagctgag
aaaatcacattggacgaagttaaacaatggctgaagcattatgatggtcgatacaaaagt
tttatcggacataaatcaacggcacagtttctgcaaaaattattaggtatcagaattgag
caaaatcgaaagactttcagacatatgaaatatcaaaaagcaatctgtttctctctgtat
gaacgatatcctgaaaacgtgttgctaacgcaaagagacttagagaaagccagataccaa
ttttatttattaactcggttagattag

DBGET integrated database retrieval system