KEGG   Bacillus subtilis subsp. subtilis 168: BSU04960
Entry
BSU04960          CDS       T00010                                 

Symbol
yddG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938141
NCBI-ProteinID: NP_388377
Pasteur: BG12114
BSORF: BG12114
UniProt: P96644 A0A6M4JD58
Position
541578..544025
AA seq 815 aa
MVVMKKKRILIVSAIVLLFLTVASAVTVFSADGDTTTQPKVEKAGGVELKVKRFPISRYQ
ANNEASDDLIKGAFVGLTNVTFSFAGNIVRVVDTGMDILYNLQPIDEFANSITNVSKTVY
KTLKKNFGEALFIFTCAYVVYLFCVRGSVKEAMRRSILFICVMVIGGLWMSNAGYYMKVL
NALSVEAQGKLLTAGNGLVGIVQDEGNFADSSAIEKGKEMEGTVAVMRNLYFDIALMKPF
LIVNFDETSEKKINEEDTDKGGLNRIDKLLSYKLSEDGEKDKKDYIKETEIDDYKNESMT
SGNVFNQLGESFIAVVASIVIGIPFLALAFFNFLLQVVALVIVFFVPFAFILAYVPQLAY
SGFVTLGRLGSVYLLKAMLGVIVLFVYVTCFIVDKLIPPNGFGMYLLNVAVLASILWIGF
HKRDAIIKFVTAGKVVSVDNNMMENMRQNIVQPAWEQAKKIGGVWGNGGGVFTDFTKHFG
GRKDGSNADGVTGAPSGGGNSPSGTAMGYDNTHAISRTPQKETANGIANHNSRSLKRNPQ
TLSKEQEKQKQKEAFANAKENKQQSHLARLRKDGINSPMLKDALNEGNEDLSKRAPILQD
KKDESARTDQKEYVEQLLKQPNNQQQTDDASLQHEEESTSNRAPVLQENEKDTERTDQKA
YIYDEQNQNLETDQQQDFEVQKDDSVSNSEPVAQEKTAEIKRSDQKVMMNQPEPQLGFES
PQSTKVENQPIANNERKIRPSEPAKVHSDGIRVDEKQAVAPAENKTVSREKQPSSQTIKR
TEQSVNSFDQVSLNEIARRSSSKVEDRLRRDERTR
NT seq 2448 nt   +upstreamnt  +downstreamnt
gtggttgtaatgaaaaagaaaagaattttgattgtgtcggctattgtgttgctgttttta
actgttgcttcagctgtaacggtattttcggctgatggagatacaacgacgcagccaaaa
gtcgaaaaagctggcggcgtggaattgaaggtgaaaaggtttccaatctcacgctatcaa
gcgaataatgaagcatctgacgatttaatcaagggggcgtttgttgggctgacaaacgtc
actttttcttttgcgggaaacattgtccgtgtggttgatacggggatggatattttgtat
aacttgcaaccgattgacgagttcgcaaattctattacaaacgtctctaaaacagtttat
aaaacactgaaaaagaatttcggtgaagctttatttattttcacgtgcgcctatgttgtc
tacctattctgtgtgagaggtagcgtaaaagaagcaatgcggcggagtattctatttatt
tgtgtcatggtgatcggtgggctttggatgtcgaacgctggttattacatgaaagtattg
aatgccttgtctgtagaagctcaaggaaagcttttaactgcggggaatggattggttggc
attgttcaagatgaaggcaattttgcagacagttcagcgattgaaaaaggaaaagaaatg
gaaggcacagttgcggttatgcgtaatctttactttgacattgctttgatgaagcctttt
ttaattgtgaattttgatgaaacaagcgaaaagaaaatcaatgaggaagatacagataaa
ggcggacttaatcgtatagataaactgctttcttataagctttcagaggatggagaaaaa
gataaaaaagattatataaaagagactgaaattgatgattataaaaatgaatctatgact
tctggaaatgtgtttaatcagctgggagagtcttttatcgctgtggtcgcttctattgtc
attgggataccatttttagcattagcgttctttaatttcttgcttcaagttgtcgcttta
gtgatagttttctttgtgccatttgctttcatcttagcgtatgttcctcaattagcttat
tcgggatttgttacgcttggacgcttggggagtgtttacctactgaaagcaatgttaggg
gttatcgttctgtttgtgtacgtgacttgttttattgttgacaagttaataccgccaaat
ggttttggaatgtatcttttaaatgttgctgtccttgcttcaatcttgtggattggtttt
cacaagagggatgccattatcaagtttgtgactgctggaaaagttgtttcagttgataat
aatatgatggaaaacatgagacaaaacattgttcagcctgcttgggaacaagcgaagaaa
ataggtggagtatggggtaacggaggcggcgtatttactgactttacaaagcattttggg
ggaagaaaagacggttcgaatgctgatggcgtaactggtgctccaagtggtggcggtaat
tcaccgagtgggactgctatgggatatgataatactcatgctatttcaagaaccccgcaa
aaagaaacagctaacggaatagctaatcataacagtcgaagcttaaaacgcaatcctcaa
actctatcgaaagaacaagaaaagcaaaaacaaaaagaagcctttgcaaatgcaaaagaa
aataaacagcaatcccatttagccagattgagaaaagacggaataaactctcctatgttg
aaagatgctttgaatgaagggaatgaggatttatccaaacgagcacctatcttgcaggat
aaaaaagatgaatcagcacgaacagatcaaaaagaatatgtggaacagcttcttaaacag
cccaataaccagcaacaaactgacgatgcatcattacagcatgaagaagaatctacttct
aatcgtgcgcctgtcttacaagagaatgaaaaagatacagaacgtactgatcagaaagcg
tatatttatgacgaacaaaatcagaatcttgaaacagatcagcaacaagattttgaagtc
cagaaagatgattctgtttccaatagtgagcctgtagcacaagagaaaacagcagaaatc
aaacgatcagatcaaaaagtcatgatgaatcaacctgaaccgcagctcggttttgaaagt
cctcaatctacaaaagtagaaaatcaacctattgccaataacgaacgtaaaatcagacca
tctgaacccgcaaaagttcattcagatggtattcgtgttgatgaaaaacaggctgttgct
cctgctgaaaataagactgtatcaagagaaaaacagccttcatcacaaacaattaaacgg
actgaacaaagcgttaattcatttgaccaagtgtctttgaatgaaattgcaagacgctct
tcatcaaaagtagaagatcgactgagaagggatgaaagaacaagatga

DBGET integrated database retrieval system