KEGG   Bacillus subtilis subsp. subtilis 168: BSU04980
Entry
BSU04980          CDS       T00010                                 

Symbol
yddI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: IKI3 DivIC ZapB
Other DBs
NCBI-GeneID: 939919
NCBI-ProteinID: NP_388379
Pasteur: BG12116
BSORF: BG12116
UniProt: P96646 A0A6M4JF97
Position
545026..545532
AA seq 168 aa
MKTHIAWASACLLLVMLTGFFTIGQQTYKIEKLKDKNEVLSEKIKELNHIESTSSASENK
AFFEAFFNYSDIDIRYETVKKHTTGKGFDYAFPSRSDQKHTVSVQSELLSLESYSKPLDE
SHELFLNIVEVATTANSVTTNQVLIVQTTMKKEKDGWLVDNVQVKGNG
NT seq 507 nt   +upstreamnt  +downstreamnt
atgaaaacacatattgcatgggcttcagcttgtttattattagtcatgttaactggattt
ttcacgattggacagcaaacgtataagattgaaaagttaaaagataaaaatgaagttttg
agcgaaaaaattaaggaattgaaccatatagaatcaacaagtagcgcttcggaaaataag
gcattttttgaagcgttttttaattactccgacatagatatacgatatgaaacagttaag
aagcacacaactggaaaagggtttgattatgcattcccttctcgttctgatcaaaagcac
acagtcagcgtgcaaagtgaattactatcactagagagttattcaaagccgttagatgag
tctcatgaattgtttttaaacattgttgaagtcgccacaactgcaaattcagtcactacg
aatcaagtgttaattgtacaaacgactatgaaaaaagaaaaggatggttggttagtcgat
aatgtgcaggttaagggaaatggataa

DBGET integrated database retrieval system