KEGG   Bacillus subtilis subsp. subtilis 168: BSU04990
Entry
BSU04990          CDS       T00010                                 

Gene name
yddJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4467
Other DBs
NCBI-GeneID: 939925
NCBI-ProteinID: NP_388380
Pasteur: BG12117
BSORF: BG12117
UniProt: P96647 A0A6M3ZKR3
Position
545595..545975
AA seq 126 aa
MKNLFIFLSLMMMFVLTACGGSKYDDAIDDVISQYKEHKGNDTEINIKRENAIVRVYEGG
KYIQFAFYMPDNSSRELTTFKYYEKFGDKYEKMTDMPGNGENDRLGLSKKTPDYEEVKGE
ETELEE
NT seq 381 nt   +upstreamnt  +downstreamnt
ttgaaaaacctttttattttccttagtttgatgatgatgtttgttttaactgcatgtggt
ggaagcaagtatgatgatgcgattgatgatgtaattagccaatataaagagcataaagga
aatgacacagagataaatattaaaagagagaatgcgattgttagagtctatgaagggggc
aaatatattcagtttgcattttatatgccggataactcttcacgtgaattaacaacattt
aagtattatgaaaaatttggagataaatatgaaaagatgactgatatgccggggaatggg
gaaaatgatcgtctggggttatcaaagaaaacaccagactatgaagaagtaaaaggagaa
gagacagagttagaggagtaa

DBGET integrated database retrieval system