KEGG   Bacillus subtilis subsp. subtilis 168: BSU05000
Entry
BSU05000          CDS       T00010                                 

Symbol
yddK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TIR_2
Other DBs
NCBI-GeneID: 939917
NCBI-ProteinID: NP_388381
Pasteur: BG12118
BSORF: BG12118
UniProt: P96648 A0A6M4JFT1
Position
complement(546166..546966)
AA seq 266 aa
MDTLKKLKFEANGIIGVLLDYSREPVLTNIIDQFRTSLESNDIELIRYSLEQLKTWYARN
RNEIYKNEFVFNEFEHHETENKIKKFLDELPVVDETEKSSITHFSSDQNRELEKKIFISH
SSKDKIVCNAFVELLEDIGVSSEDIIYTSSPYHGIPGDEDIFEYLKKHLFKGAYVFYMLS
DNYYDSVYCLNEMGATWVNSNNCSTFILPGFKGEIKGVIDKNKKAFSLEEPIDLFNLKEK
ILRMYDLTLEDKKWERIKAKFNTKLK
NT seq 801 nt   +upstreamnt  +downstreamnt
atggacacattaaaaaaattaaaatttgaggctaatggaattataggagtacttctagat
tactctcgcgagcctgtactcacaaatattattgatcaatttcgaacatctcttgaatca
aatgatattgagttaattcgttattcactagaacaacttaagacttggtatgcacgaaac
cgcaatgaaatatataaaaatgaatttgtttttaatgagtttgaacatcatgaaacagaa
aataaaataaaaaaatttttagatgaattgcctgtagtagatgagactgaaaaaagcagc
ataactcacttttcaagtgatcaaaatagagaattagagaaaaaaatatttattagccac
tcctcaaaagacaaaattgtatgtaatgctttcgttgaattactagaggatataggagtg
tcttctgaagatataatatacacttcttcaccttatcatggtattcctggagatgaagat
attttcgaatatctaaaaaaacatctttttaagggtgcatatgtcttttatatgttatcc
gataattactatgatagcgtatactgccttaatgaaatgggggctacttgggtgaatagc
aataactgctctactttcatcctccctggttttaagggcgaaataaaaggagtaattgat
aaaaataaaaaagcattctccttggaggaaccaatagacttatttaatttaaaagaaaaa
atactccgtatgtatgatctcacattagaagataaaaaatgggaaaggataaaggctaaa
tttaatacgaaattaaaataa

DBGET integrated database retrieval system