KEGG   Bacillus subtilis subsp. subtilis 168: BSU05010
Entry
BSU05010          CDS       T00010                                 

Symbol
rapI
Name
(RefSeq) response regulator aspartate phosphatase I
  KO
K06367  response regulator aspartate phosphatase I [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU05010 (rapI)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU05010 (rapI)
SSDB
Motif
Pfam: RapH_N TPR_12 TPR_2 TPR_1 ANAPC3 TPR_8
Other DBs
NCBI-GeneID: 938127
NCBI-ProteinID: NP_388382
Pasteur: BG12119
BSORF: BG12119
UniProt: P96649 A0A6M4JFP4
Structure
Position
547306..548481
AA seq 391 aa
MRGVFLDKDKIPYDLVTKKLNEWYTSIKNDQVEQAEIIKTEVEKELLNMEENQDALLYYQ
LLEFRHEIMLSYMKSKEIEDLNNAYETIKEIEKQGQLTGMLEYYFYFFKGMYEFRRKELI
SAISAYRIAESKLSEVEDEIEKAEFFFKVSYVYYYMKQTYFSMNYANRALKIFREYEEYA
VQTVRCQFIVAGNLIDSLEYERALEQFLKSLEISKESNIEHLIAMSHMNIGICYDELKEY
KKASQHLILALEIFEKSKHSFLTKTLFTLTYVEAKQQNYNVALIYFRKGRFIADKSDDKE
YSAKFKILEGLFFSDGETQLIKNAFSYLASRKMFADVENFSIEVADYFHEQGNLMLSNEY
YRMSIEARRKIKKGEIIDENQPDSIGSSDFK
NT seq 1176 nt   +upstreamnt  +downstreamnt
ttgcggggtgttttcttagataaagataaaattccgtacgacttagtcacgaaaaagtta
aatgaatggtatacatcaataaaaaatgatcaagttgagcaagccgagattataaaaaca
gaagtagagaaagaattgttaaacatggaagaaaatcaagatgccctgttatattatcaa
ctattagaatttagacatgagataatgctgagttatatgaaatctaaggaaatagaagat
ctcaataatgcttatgagactataaaagaaattgagaagcaagggcaattaactggcatg
ttggaatactatttttacttttttaagggtatgtacgagtttaggcgtaaagaattaatt
tcagcgataagtgcttatcgaatagctgaatcaaagttgtcagaagttgaggatgaaata
gagaaagcagagttttttttcaaagtgtcctatgtatattattatatgaaacaaacatac
ttctccatgaattatgcaaatcgtgcactcaaaatatttagagagtatgaagaatatgct
gtccagactgtgcgttgtcaatttattgtagcaggaaacttgatcgattcattggaatat
gaaagagccttggaacaatttttgaagtctttggaaatttccaaggaaagtaacatagag
catttaattgcaatgtcacatatgaatattgggatttgttatgatgaattgaaagaatat
aagaaggcttcacaacatttaattttagcgttagaaatttttgaaaaatcaaaacatagt
ttcttaacaaagactttattcactctaacctatgtagaagcaaaacaacaaaattataat
gttgctttgatatactttaggaaagggcgatttattgccgataaaagtgatgataaggaa
tactcagcgaaattcaaaatattagagggattatttttttctgatggtgagactcaatta
ataaagaatgcattttcatatctggcttcgagaaaaatgtttgctgatgttgaaaatttt
tcgattgaagtcgctgattattttcatgaacaaggaaatttaatgctctctaatgaatat
tatcgtatgagtattgaagcaagacgaaaaattaaaaaaggggagattattgatgaaaat
cagccggattctattggcagcagtgattttaagtag

DBGET integrated database retrieval system