KEGG   Bacillus subtilis subsp. subtilis 168: BSU05030
Entry
BSU05030          CDS       T00010                                 

Symbol
yddM
Name
(RefSeq) helicase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DegS GramPos_pilinBB DUF4446 CENP-H MpPF26
Other DBs
NCBI-GeneID: 938134
NCBI-ProteinID: NP_388384
Pasteur: BG12120
BSORF: BG12120
UniProt: P96650
Position
548710..549651
AA seq 313 aa
MGENMFKKEKVTEYIWTILIPTIITFIISWVGSYYNGTSTVSIGQPTKVSGQYITPINIS
PYHDIKELRITFPQKLDVKQISSNEPINVKSDKNNIGVESNSTFEIAKIVENNSVQLLIT
TQKKLNDKEIRIDKNGNNISVNYESQIVNPAKKQLINLIITSSIYFIMLNILALIMNKRW
DKYYAKMKNEIKEFEDNAKDLDKKSKKKSEELSELRKTLNQAFEETDRIKYHEKKKQILL
LAKLNDYKKELTFWRNTIRKVLYELPDGDKKADKLIGTVTSSLKTYGTVEKNEHDYESLK
VAAALLNDSDKRS
NT seq 942 nt   +upstreamnt  +downstreamnt
gtgggggaaaatatgtttaaaaaagaaaaagtcacagaatacatttggactatactaata
ccaacaatcatcacttttatcattagttgggttgggtcttattacaatggtacttcgaca
gttagtattggacaacctacaaaagtttccggtcagtatatcacgccaataaatataagt
ccctatcatgatattaaggaattaagaataacttttccgcaaaaactagatgtaaaacaa
attagttcaaatgagcctataaatgtaaaatcagataagaacaatataggagttgaaagt
aattccacttttgagattgcgaaaatcgttgaaaataatagcgttcagttgctaattaca
acacaaaaaaagttaaacgataaggaaattagaattgataaaaatggaaataacatttct
gtaaattatgaatctcagattgttaatcctgcaaaaaaacaattaatcaatcttataatt
acgtcatctatttattttataatgcttaatatactagcattgattatgaacaaaagatgg
gataagtattatgcaaaaatgaaaaatgaaatcaaagaatttgaggataatgcaaaagat
cttgataaaaaatcaaagaagaaaagcgaggaattatcggagctgcgaaagaccttgaac
caagcgtttgaggaaactgataggataaaatatcatgagaagaaaaaacaaatcctcctc
ttagctaagttaaacgattataaaaaagaactaaccttttggagaaatacaataagaaaa
gttctttatgaacttcctgatggagataaaaaagcagataaactaatagggacagttaca
tcatctttaaaaacgtacggtacagtcgaaaaaaacgagcatgattatgaaagtttaaaa
gtagcagctgccttactaaatgattctgataagagatcgtaa

DBGET integrated database retrieval system