KEGG   Bacillus subtilis subsp. subtilis 168: BSU05040
Entry
BSU05040          CDS       T00010                                 

Symbol
yddN
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Bac_luciferase
Other DBs
NCBI-GeneID: 938133
NCBI-ProteinID: NP_388385
Pasteur: BG12121
BSORF: BG12121
UniProt: P96651 A0A6M3Z7T0
Position
complement(550240..551259)
AA seq 339 aa
MKKFDISVLSVAPLRQGETMKQGIDSAVSLAKAVDNMGYKRIWFAEHHNHDAYASAATVS
IVQHILANTKDIRVGSGGIMLPNHSPLIVAEQFGTLETLYPNRVDLALGRAPGTDQKTAD
VIRRSNHNGVFFFEREVNDILRFVGDKSVQGEVRAYPGIGTHVPVFVLGSSTDSAEIAAK
LGLPYAFGAQFSPHSMEEALSIYRENFQPSSYLQEPYVIACINVIAAESIDEASFISASH
LQVYIDIYTNNLSKLIPPTENFLESLSQFELEILHSRLGYTIMGDRETIRRELIDFQQMY
HADELIVLSNIYELSKEIQSYEILKQVVDELFKKRMEQL
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgaaaaaatttgatatatctgttttatcagttgctccattaagacaaggagaaacaatg
aaacaagggattgattctgcagtgtcattagctaaagctgtagataatatgggctataaa
cggatttggtttgcagagcatcataatcacgacgcttatgcaagtgcagcaaccgtatca
attgtacaacatatattagcaaatacaaaagacattcgcgtaggttcagggggtattatg
ttgccaaatcattccccattaatcgtagcggagcaatttggaacacttgaaacattatat
ccaaatcgtgtagatttggcattaggacgcgcacccggaacggatcaaaaaacggccgat
gtgattcgtcgttccaaccataatggagtgtttttctttgaaagagaagtaaatgatatt
ttgcgttttgtcggggataagagtgtacagggtgaggttcgcgcttatccgggtattgga
acgcatgtgcctgtttttgtgttaggatcctcaacggattcagcggaaattgctgcaaag
cttggtttaccctatgcatttggcgctcaattttcaccccattcgatggaagaagcgctc
tctatttatcgagaaaatttccaaccgtcttcttatttacaagaaccttatgtgatcgct
tgcattaatgtgattgcagcagaatctatagacgaggcatcttttatttctgcaagtcat
ttgcaggtgtatattgatatttatacaaataatttaagtaagcttattccacccactgaa
aacttcctagaatcgttatcacagtttgaattagaaattctccacagtcgactggggtat
acaatcatgggtgatcgagaaacaattcgtcgcgaactaattgatttccaacaaatgtat
cacgcagatgaattaattgtgttatctaatatttacgaattgagcaaggaaattcagtcg
tacgagattttaaaacaggttgtggatgagttgtttaaaaaaagaatggagcaactttag

DBGET integrated database retrieval system