KEGG   Bacillus subtilis subsp. subtilis 168: BSU05050
Entry
BSU05050          CDS       T00010                                 

Symbol
lrpA
Name
(RefSeq) AsnC family transcriptional regulator
  KO
K03719  Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU05050 (lrpA)
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU05050 (lrpA)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   Lrp/AsnC family
    BSU05050 (lrpA)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucleoid associated proteins
    BSU05050 (lrpA)
SSDB
Motif
Pfam: HTH_24 HTH_AsnC-type AsnC_trans_reg PCI MarR MarR_2
Other DBs
NCBI-GeneID: 938119
NCBI-ProteinID: NP_388386
Pasteur: BG12122
BSORF: BG12122
UniProt: P96652 A0A6M3Z7Q3
Position
551519..551929
AA seq 136 aa
MIDEIDKKILDELSKNSRLTMKKLGEKVHLTAPATASRVVKLIDNGIIKGCSIEVNQVKL
GFSIHAFLNIYIEKIHHQPYLAFIETQDNYVINNYKVSGDGCYLLECKFPSNEVLDQFLN
DLNKHANYKVSIVIGK
NT seq 411 nt   +upstreamnt  +downstreamnt
atgattgatgaaatagataaaaaaatacttgatgagctgtctaaaaatagtcgccttaca
atgaaaaaattaggggaaaaagtacatctcactgcaccagcaaccgcatcaagagtagta
aagttaatagacaatggcataataaaaggatgtagtatcgaagtgaatcaagtgaaatta
ggcttctctatacatgcttttcttaatatttatatcgaaaaaatccatcatcaaccctat
ttagcttttatagaaacacaagataactatgtaataaacaattataaagttagtggagac
ggttgctatttgcttgaatgtaaatttccttcaaacgaggtattagatcaatttttaaat
gacttaaataaacatgcaaactataaagtgtcgattgttattggtaaatag

DBGET integrated database retrieval system