KEGG   Bacillus subtilis subsp. subtilis 168: BSU05060
Entry
BSU05060          CDS       T00010                                 

Symbol
lrpB
Name
(RefSeq) AsnC family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_24 HTH_AsnC-type AsnC_trans_reg HTH_11 MarR MarR_2 CM_2 Mga HTH_34
Other DBs
NCBI-GeneID: 939912
NCBI-ProteinID: NP_388387
Pasteur: BG12123
BSORF: BG12123
UniProt: P96653 A0A6M4JIT2
Position
complement(552052..552501)
AA seq 149 aa
MQIDSIDFQILQLLNKNARIQWKEIGEKIHMTGQAVGNRIKKMEDNGIIKAYSIVVDELK
MGFSFTAFVFFFMNAYMHDDLLKFIATRNEISEAHRVSGDACYLLKVTVHSQEVLNHLLN
DLLKYGNYQLYLSIKEVKKHYNTSLMSDE
NT seq 450 nt   +upstreamnt  +downstreamnt
atgcaaattgattcaattgattttcaaattctccaattattaaataaaaatgctcggata
caatggaaagaaatcggtgaaaaaattcatatgacaggacaagcggtaggcaatcgcatc
aaaaaaatggaggataacggtatcattaaagcatattcgattgtggttgatgaattgaag
atggggttttcttttacagcctttgtcttctttttcatgaatgcatatatgcatgatgat
ttattgaaatttattgctactcgtaatgaaattagcgaagctcatcgtgtttcgggagat
gcatgttatcttctgaaggtaacggttcattcacaagaagttttaaatcaccttctgaat
gatttattgaagtatggaaactatcagctttatttgtctattaaggaagtaaaaaagcat
tataatacttcattaatgtctgatgaataa

DBGET integrated database retrieval system