KEGG   Bacillus subtilis subsp. subtilis 168: BSU05070
Entry
BSU05070          CDS       T00010                                 

Symbol
yddQ
Name
(RefSeq) isochorismatase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Isochorismatase
Other DBs
NCBI-GeneID: 938129
NCBI-ProteinID: NP_388388
Pasteur: BG12124
BSORF: BG12124
UniProt: P96654 A0A6M3Z7Z1
Position
552616..553158
AA seq 180 aa
MTTALLVIDIQNDYFPNGKMALTNPEKAAQNAAKLLSHFRNTGAPVFHVQHITEGNIAHF
FHPNTEGVEIHESVRPLEKETVIVKHMPNSFFNTDLNGKLQEEGVKELVVCGMMSHMCID
ATVRSAVEHGYVCQVVEDACATTTLQIEDKIVPAEHVHYAFMAALNGVYATVKTTEAFLK
NT seq 543 nt   +upstreamnt  +downstreamnt
atgacaacagctttattagtgattgatattcaaaatgattactttccaaatgggaagatg
gctttaacaaacccagagaaagcagcacaaaatgcggctaaactactttcacactttaga
aacacaggcgcacctgtctttcatgtacagcatatcacagaaggtaacatcgctcatttt
ttccatccaaatacagaaggtgtcgaaattcatgagtcagtacgtccattagagaaagag
acagtcattgtaaaacatatgccgaatagctttttcaatacagatttaaatggaaagcta
caagaagaaggggttaaagaattagttgtttgcggtatgatgtcccatatgtgtattgat
gcaacagttcgttctgcagttgaacatggttatgtatgccaagtggtagaagatgcttgc
gcaacaacaacattgcaaattgaagataaaatcgttcctgctgagcatgtccattacgca
tttatggccgcattaaatggtgtctatgcaacagtaaaaaccacagaggcatttttaaaa
taa

DBGET integrated database retrieval system