KEGG   Bacillus subtilis subsp. subtilis 168: BSU05080
Entry
BSU05080          CDS       T00010                                 

Symbol
yddR
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Lactamase_B_2 Lactamase_B_3 Lactamase_B
Other DBs
NCBI-GeneID: 939915
NCBI-ProteinID: NP_388389
Pasteur: BG12125
BSORF: BG12125
UniProt: P96655 A0A6M3ZD10
Position
553711..554475
AA seq 254 aa
MNITQIRNATIVVKYANKKFLIDPMLAEKGTYATFPETIRQDLFNPLVSLPTSIDNILDG
VDAVIVTHLHLDHFDDVAKNVLPKNIKMFVQNEADAKEVKASGFKNVEVLHQDTVFEGIQ
LVKTKGEHGRGEELLNLMGDVCGLVFKHPSEKVLYVAGDTVWYDAIEDEIHTHQPEIIVV
NGGDNQRLDLGSLIMGKEDIYEVHKAAPHAKIISVHMEAVNHWTLSREELKNFSKEKGFS
SNILVPEDGESYTF
NT seq 765 nt   +upstreamnt  +downstreamnt
atgaatattacacaaattcgaaatgcaacaattgttgtaaaatacgcaaataaaaaattt
ttgatagatcctatgttagcagagaaaggtacgtacgctactttccctgaaacgatcaga
caagatttatttaatcctttggtgagtttgccaacatcaattgataacattctggatggc
gtagatgcggtaattgttactcatctacacctagatcactttgatgatgtggcaaaaaac
gtattgccaaaaaacatcaaaatgtttgttcaaaatgaagcagatgcaaaagaagtaaaa
gcaagtggtttcaaaaatgtagaagtgctacatcaagacactgtttttgaagggatccaa
ttagtaaaaacaaaaggtgaacatggcagaggggaagagttattaaacttaatgggtgat
gtttgtggattagtattcaagcacccaagtgaaaaagttttatatgtagctggggataca
gtttggtatgatgctatcgaagacgagattcatacacatcaaccagaaatcattgtggtt
aatggtggagacaatcaaagattagatttaggttcactcatcatgggaaaagaagacatc
tatgaagttcacaaggctgctcctcatgctaagattatatctgttcatatggaagctgtt
aaccattggacactatctagagaagaattaaaaaactttagtaaagaaaaaggattctca
agtaatattttagtgccagaagatggcgagtcttacacattttaa

DBGET integrated database retrieval system