KEGG   Bacillus subtilis subsp. subtilis 168: BSU05090
Entry
BSU05090          CDS       T00010                                 

Symbol
yddS
Name
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_2 MFS_1_like TRI12
Other DBs
NCBI-GeneID: 938128
NCBI-ProteinID: NP_388390
Pasteur: BG12126
BSORF: BG12126
UniProt: P96656 A0A6M3Z8C6
Position
554669..555979
AA seq 436 aa
MVMTKKDTNISTQQPLWLQGYIDSPEKQNQLYKKTLKILIFSQIFGGAGLGAGITVGALL
AQDMIGSENVAGIPTALFTFGSAVAALLIGASSQRFGRRAGLAGGFLIGGLGAIGVIIAA
LINSVALLFVSLLIYGAGMASNLQVRYAGTDLANEKQRATAASMALVSTTLGAVVGPNLV
NTMGEFADSIGVPNLAGPFIMSGAAFIIAGIILLIFLRPDPLFVSTAIANAEKKDDKVQI
GGSLKNPAIDKKGIMVGAVIMILAQLIMTAIMTMTPVHMGHHGHGLSEVGLVIGLHIAAM
YLPSPLTGLLVDKFGRTTMAIASGATLLAAGLVAAIAPADSLSLLILALVLLGVGWNFGL
LTGTALIIDSTHPSLRAKTQGTFDVLLALSGAAGGALSGMVVAHSSYTILSISGAVLSLL
LIPVVIWYFRRIQEKA
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggtaatgacaaaaaaagatacaaatatatcaacacagcagcctctttggttacaaggt
tatattgattcaccagaaaaacaaaaccaactttataaaaaaacattaaaaatcttgatt
ttttcacaaatatttgggggagcaggacttggagctgggataacagttggggcgcttctt
gcacaagatatgataggatcggaaaatgtagcaggaattccaactgccctctttactttt
ggatctgccgtagctgccctgcttataggagcatcctcacaacgttttggtcgcagagct
ggacttgcaggtggtttccttataggcggattaggtgctataggtgtgataatcgcggct
ttaattaacagcgttgccctattatttgtttctcttcttatttatggagcaggtatggct
tctaatcttcaagttcggtatgctgggacagaccttgcaaatgagaaacaacgggcaact
gctgcaagtatggccttagtttctactactttaggagctgtagtaggtcctaacttagtt
aatacaatgggggaatttgcagattcaattggtgttcccaatttagctggtccgtttatt
atgtcaggagcagcttttataattgctggaattattctcttaatttttcttcgtccagat
ccgctgtttgtatcaacagctattgcgaatgctgagaaaaaagacgataaagtacaaata
ggaggaagtctaaaaaatcctgctatagacaaaaaaggaataatggtaggagctgtcatt
atgattttagctcaactaatcatgacagctattatgacaatgacaccggttcacatgggt
catcacggtcatggtttaagcgaagtgggattagttataggactccatattgcagcgatg
tatcttccttcaccattgactggtttattagtagataagtttggtcgcacaactatggct
attgcttcaggtgccacacttcttgccgctgggttggtggcagctattgcaccggcagac
tcattatcattgctaatcctagcactagtattactaggggtaggttggaactttggttta
ctaacgggaactgcccttattatagattcaacacatccatctctacgtgcaaaaacacag
ggaacattcgatgttttattagcactatcaggagcagcaggtggagccttgtcaggaatg
gttgttgcacattctagttatacaatactatcaatttctggagccgttttatcattgtta
ctcattccagtagttatttggtattttagaaggattcaggaaaaagcataa

DBGET integrated database retrieval system