KEGG   Bacillus subtilis subsp. subtilis 168: BSU05099
Entry
BSU05099          CDS       T00010                                 

Symbol
ydzM
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303141
NCBI-ProteinID: YP_003097682
UniProt: Q9K3A9 A0A6M3Z884
Position
556562..556738
AA seq 58 aa
MNNKKNIFDIVMYIIFGVLSLFLVAKTDYGTGVLVFVAILYLAVIAYKIKQVFSNSDS
NT seq 177 nt   +upstreamnt  +downstreamnt
atgaacaacaagaaaaatatctttgatattgttatgtacattattttcggtgtgttaagt
ctttttctagttgcaaaaactgattatggcactggagttttagtgtttgttgcaatttta
tacctcgctgttattgcttataaaattaagcaagtatttagtaattcagattcttaa

DBGET integrated database retrieval system