KEGG   Bacillus subtilis subsp. subtilis 168: BSU05100
Entry
BSU05100          CDS       T00010                                 

Symbol
yddT
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Laminin_G_1
Other DBs
NCBI-GeneID: 939913
NCBI-ProteinID: NP_388391
Pasteur: BG12127
BSORF: BG12127
UniProt: P96657 A0A6M3Z7R6
Position
556763..557449
AA seq 228 aa
MRKKRVITCVMAASLTLGSLLPAGYASAKEDSKTTPSYEELALHYKMKSEKISSNGKLVE
IEYVSGNETHKVQMNGNNHTVKVDGIEQKGLNFEYDENVAKRTNYENNNLKSNEFTTQAA
KPKKGYHYVGTLSGHTKAAKNALSVTMSLVGIVPGLGWGSKAATILFSYWAKEQIPDAYY
KYDLYEKGAMTDSWYQYATVQFFEDKAHKKKMGKPWTSTPAKVDLPNS
NT seq 687 nt   +upstreamnt  +downstreamnt
ttgagaaagaaaagagttattacttgtgttatggctgcatcattgactttaggctcactt
ttacctgcaggttacgcttctgcaaaggaggactctaagacaaccccttcttacgaagaa
ctagctctacattacaaaatgaaaagtgaaaagatttcatcgaacgggaaattagttgaa
attgagtatgtgagtggaaatgaaactcacaaagttcagatgaacggaaataatcatact
gtaaaagtcgatggcatagaacaaaaaggtttaaactttgagtatgatgaaaatgttgct
aaaagaacaaattatgaaaacaataatttgaaatcaaatgaattcacaacacaggctgca
aaacctaaaaagggataccattatgtggggactttatctgggcatacaaaagcagctaaa
aatgcgttatcagttacaatgtcattagtcggtattgtccctggcttgggatgggggagt
aaggctgccactattttattctcttattgggcaaaagaacaaatccctgatgcgtattat
aaatatgatttatacgaaaaaggagcaatgactgatagttggtatcagtatgctacagtt
caattttttgaagataaagctcataaaaagaaaatgggcaaaccttggacaagtactcct
gcaaaagtagatttacctaatagctaa

DBGET integrated database retrieval system