KEGG   Bacillus subtilis subsp. subtilis 168: BSU05109
Entry
BSU05109          CDS       T00010                                 

Symbol
ydzN
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3804
Other DBs
NCBI-GeneID: 8303142
NCBI-ProteinID: YP_003097683
UniProt: C0H3V7 A0A6M3Z7Q6
Position
557873..558058
AA seq 61 aa
MRWSKWFNVFCIVALGSIYGYKLFTNQEVSTTRLIIASVIVLWNIVGLFSKESVKQAQQA
N
NT seq 186 nt   +upstreamnt  +downstreamnt
ttgcgttggagtaaatggttcaatgttttttgtatagtagcattgggatcaatatatggt
tataaattatttactaaccaagaagtcagtactactcgtttaataatagcttctgtaatt
gtgttgtggaatattgttggactttttagcaaagaatcagtaaaacaagcacagcaagca
aattaa

DBGET integrated database retrieval system