KEGG   Bacillus subtilis subsp. subtilis 168: BSU05110
Entry
BSU05110          CDS       T00010                                 

Symbol
ydeA
Name
(RefSeq) protease YdeA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DJ-1_PfpI
Other DBs
NCBI-GeneID: 939914
NCBI-ProteinID: NP_388392
Pasteur: BG12128
BSORF: BG12128
UniProt: P96658 A0A6M4JGP8
Structure
Position
558408..559001
AA seq 197 aa
MKKALFLILDQYADWEGVYLASALNQREDWSVHTVSLDPIVSSIGGFKTSVDYIIGLEPA
NFNLLVMIGGDSWSNDNKKLLHFVKTAFQKNIPIAAICGAVDFLAKNGLLNNHSHTGNFV
YLWKDYKQYKPISSFVEKQAVRDKNLVTANGTAPIEFTNLILEMIDFDTPENIEKMMYMN
RYGFYHFCDKYGNPFVD
NT seq 594 nt   +upstreamnt  +downstreamnt
gtgaaaaaggcgttatttcttatattagaccagtatgcagattgggaaggtgtttactta
gcatctgcattaaatcaaagagaagattggtcggttcacactgtttctttagaccctatt
gtaagctcaataggtggttttaaaacatctgtcgattacataatagggttagaacctgca
aattttaatttgctagttatgattggcggggattcctggagtaatgacaataaaaaacta
ttacattttgtaaaaactgcatttcaaaaaaacattccaatagcagcgatatgcggtgca
gtggattttttggcgaagaatggtttgctgaataatcatagccatacaggtaattttgtt
tacttatggaaagattacaaacaatataaaccgattagcagttttgtagagaaacaagca
gtaagagataaaaatttggttactgctaatggaactgcccctattgaatttactaattta
attttagagatgattgattttgatactcctgagaacatagagaaaatgatgtatatgaat
cgttatggtttttatcatttttgtgataaatatggaaatccatttgttgattaa

DBGET integrated database retrieval system