KEGG   Bacillus subtilis subsp. subtilis 168: BSU05120
Entry
BSU05120          CDS       T00010                                 

Symbol
cspC
Name
(RefSeq) cold shock protein CspC
  KO
K03704  cold shock protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    BSU05120 (cspC)
SSDB
Motif
Pfam: CSD OB_RNB CusF_Ec
Other DBs
NCBI-GeneID: 938114
NCBI-ProteinID: NP_388393
Pasteur: BG11024
BSORF: BG11024
UniProt: P39158 A0A6M4JDM4
Position
559264..559464
AA seq 66 aa
MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQSDGFKSLDEGQKVSFDVEQGARGAQA
ANVQKA
NT seq 201 nt   +upstreamnt  +downstreamnt
atggaacaaggtacagttaaatggtttaatgcagaaaaaggttttggctttatcgaacgc
gaaaatggagacgatgtattcgtacacttttctgcaatccaaagtgacggattcaaatct
ttagacgaaggtcaaaaagtatcgtttgacgttgagcaaggtgctcgtggagctcaagct
gctaacgttcaaaaagcttaa

DBGET integrated database retrieval system