KEGG   Bacillus subtilis subsp. subtilis 168: BSU05130
Entry
BSU05130          CDS       T00010                                 

Symbol
ydeB
Name
(RefSeq) transcription factor YdeB
  KO
K07736  CarD family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU05130 (ydeB)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Other transcription factors
   Others
    BSU05130 (ydeB)
SSDB
Motif
Pfam: CarD_CdnL_TRCF
Other DBs
NCBI-GeneID: 938120
NCBI-ProteinID: NP_388394
Pasteur: BG12129
BSORF: BG12129
UniProt: P96659 A0A6M3Z7R2
Position
complement(560151..560612)
AA seq 153 aa
MFQIGDNIVYPMHGAGIIEAIEEKEFLEEKQQYYVIRMSISNMTVMIPTSKILSSNIRPV
TDILALKHIMHIFQHGESDRLLPWKQRYKINTDKIKTGEIQEGAEVVRDLMRMKKEKALN
ASEKKMLDNAYEFLISELEVIKGITEKQIKSFG
NT seq 462 nt   +upstreamnt  +downstreamnt
atgtttcaaattggcgataacattgtttatccaatgcacggagcaggtataattgaagcc
atagaagaaaaagaattcttagaggaaaaacaacagtattatgtcataagaatgtcaatc
agtaatatgacagttatgattccaacgagtaaaatattgagttcgaatatacgaccagtt
accgatatacttgcattaaaacacattatgcacatttttcagcatggagaatccgatagg
ttactgccatggaagcaaaggtacaaaataaacacggacaaaataaaaacaggtgaaata
caagaaggtgctgaagttgtacgtgatttaatgcgtatgaagaaagaaaaagcacttaat
gcaagcgaaaaaaaaatgctggataatgcatatgaatttttgattagtgaactggaagta
attaaaggaatcactgaaaaacaaataaaaagttttggttag

DBGET integrated database retrieval system