KEGG   Bacillus subtilis subsp. subtilis 168: BSU05140
Entry
BSU05140          CDS       T00010                                 

Symbol
ydzE
Name
(RefSeq) permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: EamA CD20
Other DBs
NCBI-GeneID: 938121
NCBI-ProteinID: NP_388395
Pasteur: BG12808
BSORF: BG12808
UniProt: O31493
Position
complement(561180..561416)
AA seq 78 aa
MYLGIVSTACAFLLWNHGLQLLNASSGGLFFFFQPLVGTLLGWILLGEQIGGTFWIGSFL
ILSGVLLVIKEKEKEVKS
NT seq 237 nt   +upstreamnt  +downstreamnt
ttgtatttgggaattgtttcaacagcttgtgcatttttattgtggaaccacggcttacaa
ttattaaatgcctcaagtggaggcctctttttcttttttcagcctctggttggaacctta
ctcggatggattctgcttggagaacaaataggcgggacattttggataggttcgttttta
attctgagcggtgttttattagtcattaaagagaaagaaaaagaagtgaagtcataa

DBGET integrated database retrieval system