KEGG   Bacillus subtilis subsp. subtilis 168: BSU05150
Entry
BSU05150          CDS       T00010                                 

Symbol
ydeC
Name
(RefSeq) AraC family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_18 HTH_AraC AraC_binding Cupin_2 AP4E_app_platf MannoseP_isomer Cupin_1 Cupin_6
Other DBs
NCBI-GeneID: 938103
NCBI-ProteinID: NP_388396
Pasteur: BG12130
BSORF: BG12130
UniProt: P96660 A0A6M4JIU0
Position
complement(561514..562389)
AA seq 291 aa
MKNFVIDQNLKELTEHRTVELPVACYKTTINQNINGYIPLHWHDEIQFVLILKGIALFQI
NEEKIEVHEGDGLFINSGYLHMAEEKEGSDCTYICLNVSPHFVLSQELYSSYVQPYMFST
NLPYLFLAGNQQWAKNILDAVKKINQLIQQKTSLYEIDITMQLTLMWKNLVVNGFQLEYD
QSEMIKSHRMKQMLNWIHLHYVEKITLEDIAKAGQLSRSECCRYFKRMLNKTPLRYVMDY
RIQKSLLLLQHPESNVTEVSYQVGFNSTSYFISKFQQAMNMTPLSYKKMNS
NT seq 876 nt   +upstreamnt  +downstreamnt
atgaagaattttgtgatcgatcaaaatttaaaagaattaacagagcaccgaacggtagaa
ttgccagttgcctgctacaagacaacgatcaatcaaaatataaatggctatattccgctt
cattggcatgatgaaatccaatttgttttgatactaaaagggatagctctctttcaaata
aatgaagaaaaaatagaggttcacgaaggggatggattatttatcaatagcggctacctg
cacatggccgaagaaaaggaaggctcggattgtacgtatatttgcttgaatgtgtcaccc
catttcgttttatctcaggaactgtattcaagctatgttcagccctatatgttttcaacc
aatttgccctatttatttttggctggaaatcaacagtgggcaaaaaatattctagatgct
gttaaaaaaataaatcaattgattcaacaaaagacatcgctctatgagattgacattacg
atgcaattaacgttaatgtggaaaaacctggtcgttaatggttttcaattagagtacgat
caatctgaaatgataaaaagtcatcgaatgaaacaaatgttaaactggatccatctccat
tatgttgaaaaaatcacattagaggacattgcaaaagctggccaactgagccgttctgaa
tgctgccgttattttaaacgaatgctgaataagacgccattacgttatgtaatggattat
agaattcaaaaaagcttattattactgcaacaccctgaatccaatgtgacagaagtgtct
tatcaagttggatttaacagtaccagttatttcataagtaaatttcaacaagcgatgaat
atgacgccattatcatacaaaaaaatgaattcataa

DBGET integrated database retrieval system