KEGG   Bacillus subtilis subsp. subtilis 168: BSU05160
Entry
BSU05160          CDS       T00010                                 

Symbol
ydeD
Name
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: EamA RseC_MucC Phage_holin_5_2
Other DBs
NCBI-GeneID: 939906
NCBI-ProteinID: NP_388397
Pasteur: BG12131
BSORF: BG12131
UniProt: P96661 A0A6M3Z804
Position
562502..563461
AA seq 319 aa
MNTSNRRMGLFYVITGATCWGIGGTVAKKLFQEYQIDVNWLVTTRLLTAGMLLLMLQLFR
KDRSQVIEVWKHKASAGQLLIFGLLGMLAVQYTYMASIQHGNAAVATLLQYLSPVIVIIY
TLLRKQTVLTKQDIITVVLALVGCFFLLTNGSMSQLSVPAAAVVWGVLSGFAAAFYTLYA
VGLLNKFDSLVVVGWAMIIGGFALGFIHPPWQLDFQRLTAEAYAYILFVILFGTMIAFWF
FIKSLESLSPKETSLLGSLEPLSAVVTTVVWLKAPFGSFQWIGAICIIGITLILALHKEP
SMESEKSILKIRNHANRDI
NT seq 960 nt   +upstreamnt  +downstreamnt
atgaatacttccaatagaagaatgggattgttctatgttatcacaggggcgacatgttgg
gggattggaggcacagtagccaaaaaactttttcaagaatatcaaattgatgtcaattgg
cttgtaacgacacgcttgcttacggctggaatgttacttttaatgctgcaactgttcaga
aaggatcgttcccaggttattgaggtgtggaaacacaaagcgtcggctggccagcttcta
atttttggcctattgggaatgctagctgtgcagtacacatatatggcatccattcaacat
gggaatgctgccgttgctacgttattgcaatatttatccccagtaatcgtcattatctac
acgctgttgcgaaaacaaacggttcttaccaaacaagatatcataactgttgtacttgct
ttagtgggttgcttttttttgttaacaaatggttcaatgtctcaactttcagtgccggca
gctgcagtagtatggggagttttatcaggattcgcggcagctttttatactttgtatgcc
gttggtttattaaataaatttgattctcttgtcgttgtaggttgggctatgattattggc
ggttttgcattgggttttatccatccgccatggcaactggattttcaacgattaactgct
gaggcgtatgcatatatcttattcgtgatattatttggaacaatgattgcgttctggttc
ttcataaaaagcttggaaagcctctctccaaaagaaacaagcctactaggcagtctagag
cctctatcagctgttgtaacaactgtcgtttggttaaaagcgccatttggttcttttcaa
tggattggtgctatttgtattatagggataactttaatattggctttacataaagagcct
tctatggagagtgaaaaatcgatattaaagattaggaatcatgcaaatcgggatatatag

DBGET integrated database retrieval system