KEGG   Bacillus subtilis subsp. subtilis 168: BSU05170
Entry
BSU05170          CDS       T00010                                 

Symbol
ydeE
Name
(RefSeq) AraC family transcriptional regulator
  KO
K13653  AraC family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU05170 (ydeE)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   AraC family
    BSU05170 (ydeE)
SSDB
Motif
Pfam: GyrI-like Cass2 HTH_18 HTH_AraC PUA
Other DBs
NCBI-GeneID: 938117
NCBI-ProteinID: NP_388398
Pasteur: BG12132
BSORF: BG12132
UniProt: P96662 A0A6M4JDD0
Position
complement(563614..564486)
AA seq 290 aa
MDLLKSMNRALKYIEENLTNDIDFQEAAKLAFCSEYHFKRMFSFLAGISLSEYIRRRRLT
LAAFELKDSNVKVIDIAIKYGYNSPDSFARAFQNLHGINPSKARFNGHSLKAYPRMTFQL
TIKGGNEMNYRIEEKEAFRIVGIKKRVPIIFKGINPEIASMWESLDEKAINKLKELSNVA
PSGLISASTNFSEGRTEENGELDHYIGAATTKRCPDNFSRLEVPASTWAVFESIGPFPDT
LQEVWGRIYSEWFPSSNYEQIEGPEILWNEHKDVTSPSFKSEIWIPITKK
NT seq 873 nt   +upstreamnt  +downstreamnt
atggatttgcttaaaagtatgaatagggcgttaaagtatattgaagaaaacctcactaat
gatattgattttcaagaggcagcaaagcttgctttctgctctgaatatcattttaaaagg
atgttttccttccttgcaggtatttcattatcggaatatattcgtcgcagacgtcttact
cttgcagcttttgaactgaaagacagcaatgtaaaagtgattgatattgcaataaagtac
ggttataactcaccagattcttttgcacgggcattccaaaatttacatggcataaaccca
tcaaaagccagatttaatggccattcccttaaagcttatccacgaatgaccttccagcta
acaattaaaggaggaaatgaaatgaactaccgtattgaagaaaaagaggcatttcgcatc
gttggcattaaaaaaagagttcctattattttcaaaggaattaatccggaaattgcatct
atgtgggaaagtttagatgaaaaagcaataaataaactaaaagagctatctaatgtagca
ccatcaggcctcattagtgcatccacgaatttttctgaaggtcggacagaggaaaacgga
gagctcgatcactatattggcgcagccacaacgaaacggtgtccagataacttctcacgg
cttgaagttcctgcctcaacatgggctgtattcgaatcaatcgggccatttccggataca
ctgcaagaagtatggggacgcatttattccgaatggtttccatcgtcaaattacgaacaa
atagaaggtccagaaatattgtggaacgagcataaggatgtaacatcaccatcttttaaa
agtgaaatttggataccaatcacaaaaaagtaa

DBGET integrated database retrieval system