KEGG   Bacillus subtilis subsp. subtilis 168: BSU05180
Entry
BSU05180          CDS       T00010                                 

Symbol
ydeF
Name
(RefSeq) GntR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Aminotran_1_2 GntR Asp_aminotransf Cys_Met_Meta_PP Beta_elim_lyase HTH_Crp_2
Other DBs
NCBI-GeneID: 939911
NCBI-ProteinID: NP_388399
Pasteur: BG12133
BSORF: BG12133
UniProt: P96663 A0A6M3Z8D7
Position
564704..566101
AA seq 465 aa
MRIMPINSFENYPMSWKPSIDKAEKPIYKALAGQLEQDILNGVLLPGTKLPPQRELADYL
DLNVSTISKAFKVCELKGLLSATVGSGTFVSYDALSNAYLLEDTKPTHLIEMGAILPDHA
SYEPLLYQLKNMVHEEDYEKWFSYGRAGESLWQKDAAVKLIQRGGFETSVDHILFANGGQ
NAIAATLASLCKPGDRIGVDHHTYPGLKTVASLLSVQIVPIKSENDEMSPESLEYACKNE
NIKGLYLIPDYHNPTTSFMSVENRRMVADIVKKYNLFVIEDASYHLLNKNPLPALASFAP
QQVIHIASLSKSLAPGLRLAYVAVPRQYKEPISKALYNLNITVSPLLAELTARTIVSNQF
EVLIESHREQTIRRNQLVNRYVAGYTCLGVETGIFRWLLLPGKMSGAEFEELAARLGVQV
YAAERFVVGNSCPERAVRVSVCAPKTLEELEQGLMILRRLLDDLT
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgcgtatcatgcctatcaattcttttgaaaattatccgatgagctggaagccatcgatt
gataaagctgaaaagcctatttataaagcacttgcagggcaattggaacaggatatttta
aacggagttttattacctggaacaaaacttcctccacagcgagaattggccgattatcta
gatttaaatgtgagtacgatttcaaaagcatttaaagtgtgtgagttaaaagggctgctg
agtgcgactgtagggagcggcacatttgtatcgtatgatgcgttgtcgaatgcgtattta
cttgaggatactaagccgacacatttaattgaaatgggagcaatacttccagatcacgct
tcatatgagcccttgttataccaactgaaaaacatggttcatgaggaggattatgaaaaa
tggtttagctatggccgggcaggtgaaagcctttggcaaaaagatgcagctgtaaagctc
atccaaagaggcggatttgaaacatccgttgatcacattttatttgcaaatggagggcaa
aatgcgattgcagcgacattggcgagtctttgtaagcctggagatcgcatcggagttgac
catcatacgtaccctggattaaaaactgttgcatcattgcttagtgtgcaaatcgtaccg
ataaaatcagaaaacgatgaaatgagtccggagtcacttgaatatgcgtgtaaaaacgaa
aatattaaaggtttgtatttaatcccggattatcataatccgacgacttcctttatgtct
gttgagaatcgaagaatggttgcagacattgtaaagaaatataatctgtttgttattgag
gatgcatcgtaccatcttctcaacaaaaatccgcttccggcactcgcctcattcgcaccg
caacaggttattcatattgcaagtttatcaaaatcgttagcgccaggcctgcgtttggct
tatgtagcagtgccgagacaatataaggagccaatatcaaaggcgctttataatttaaat
ataactgtttccccgctattagctgaacttactgctcgcacgattgtatcaaatcaattt
gaagtcttaattgagagtcatcgtgaacaaaccattcgcagaaatcaactcgtaaaccga
tatgttgcgggatatacatgtttaggtgttgaaacaggcatttttcgttggttgttgtta
ccgggtaaaatgtctggtgccgaatttgaagaattggctgctcgacttggcgtgcaagtg
tatgcggctgaacgctttgtagtgggaaatagttgtcctgaaagggctgtaagggtttct
gtctgtgcaccaaaaacacttgaagagcttgaacaaggattaatgatcctgagacgtttg
ctagacgatcttacctaa

DBGET integrated database retrieval system