KEGG   Bacillus subtilis subsp. subtilis 168: BSU05200
Entry
BSU05200          CDS       T00010                                 

Symbol
ydeH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1385
Other DBs
NCBI-GeneID: 938097
NCBI-ProteinID: NP_388401
Pasteur: BG12135
BSORF: BG12135
UniProt: P96665
Position
567662..568108
AA seq 148 aa
MNHIKWLSDLKKAGLLALGKGVITLLKRFSLVIVTLMMSIVVVLAAAKESPGDHVISFDE
PIILMISIGIVVFLLIPPLVMSFFGNLVVRIISGVYQCFIVFTFLGLIPIGFLIPNGFLT
ILVSIAGTLVSIASVAVTLCIGKNKKDI
NT seq 447 nt   +upstreamnt  +downstreamnt
ttgaatcacataaaatggttatcggatttgaaaaaggcaggattactcgctttaggtaaa
ggagtcataacgttgttaaaaaggttttctcttgttattgttacactaatgatgtctatc
gttgttgttttagcggctgctaaagagtcgcctggagatcatgtcatctcatttgatgaa
cctattatcttgatgatctcaattggaatcgttgtatttttattgatccctccattagtc
atgtccttttttggcaatttggttgtaagaataatatctggtgtataccaatgttttatc
gttttcacttttctggggctcattccaattggatttcttattcccaatggctttttgaca
attctagtttctattgcaggaactttagtcagtatagctagtgttgccgtaaccttatgc
attggcaagaataaaaaagatatataa

DBGET integrated database retrieval system