KEGG   Bacillus subtilis subsp. subtilis 168: BSU05210
Entry
BSU05210          CDS       T00010                                 

Symbol
ydeI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: OmdA DUF1801 DUF5655
Other DBs
NCBI-GeneID: 939916
NCBI-ProteinID: NP_388402
Pasteur: BG12136
BSORF: BG12136
UniProt: P96666 A0A6M4JFR0
Position
568345..568938
AA seq 197 aa
MTNSRTNPKVDEFLSKAKKWKEEFEKLRTIILDCELTEDFKWMHPCYTYHNKNIVLIHGF
KEYCALLFHKGVLLQDTDGILIQQTENVQAARQIRFTNVQEINELENILKAYIHEAIEVE
KAGLKVDVNKNIELNIPEELQNKFDEIPALKIAFEALTPGRQRAYTLYFSQAKQSKTRES
RVEKYVQKILDGKGLKD
NT seq 594 nt   +upstreamnt  +downstreamnt
atgacaaatagcagaacaaatccgaaggttgatgaatttttaagtaaagcgaaaaagtgg
aaggaagaatttgagaagttgagaaccatcattcttgactgtgagctgactgaagatttt
aagtggatgcatccttgttacacatatcataataaaaatattgttttaatacatgggttt
aaagaatattgcgcgcttctgttccacaaaggcgtcttattacaggatacagatggaatt
ctcattcaacaaacggagaatgtacaggcggcgcgccagattcggtttacaaatgttcag
gaaataaatgagctagaaaacattttgaaagcctatattcacgaagccattgaagttgaa
aaagccggtttgaaagtggatgttaacaaaaatattgaattgaacattcctgaagaactt
caaaataaattcgatgaaatccctgcattgaaaattgcttttgaagctttgaccccggga
cggcaaagagcgtacactctttatttttctcaagccaaacaatccaaaacccgagaatcg
agagtcgaaaaatatgtgcaaaaaattctcgatggaaagggattaaaggattag

DBGET integrated database retrieval system