KEGG   Bacillus subtilis subsp. subtilis 168: BSU05220
Entry
BSU05220          CDS       T00010                                 

Symbol
ydeJ
Name
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SpoIIIAH
Other DBs
NCBI-GeneID: 939910
NCBI-ProteinID: NP_388403
Pasteur: BG12137
BSORF: BG12137
UniProt: P96667 A0A6M4JFH2
Position
complement(569290..569949)
AA seq 219 aa
MKKRRKICYCNTALLLMILLAGCTDSKDGEAQQPSNQASAVQTDEKHTEPEESTKIRKDE
AEPITESEESATKAANDTSSAEEKSKEDNVLAAYSSEKIEYARVWLQLGPNQEIDELNVR
HIAAGEPINPNDDTSASYPENVTQLAGSRLVDGSVTYHGNGDGTIHVYNVPLRWDSADDI
EKGVMREVTESIIKNRKTVYVDTGDDEKIKRLIDIMMIH
NT seq 660 nt   +upstreamnt  +downstreamnt
atgaagaaacgcagaaagatatgttattgcaatactgccctgctgcttatgattttgctt
gctggatgtacggacagtaaggatggagaagcacaacaaccttcaaatcaagcttctgct
gtgcaaactgacgaaaaacacactgagcctgaagagagcaccaaaatacgcaaggatgaa
gcggagccaataacagaatcagaagaatccgcaacaaaagctgcaaatgatacctcttca
gcagaagagaaaagcaaagaagacaatgtattggcagcatactcttcggaaaaaattgaa
tatgccagagtttggcttcaacttggacctaatcaagagatagatgaattaaatgttcga
catattgcggctggcgagccaattaatcctaatgatgatacaagtgccagctatccagaa
aatgtgacccagttggcaggttctcgtttagtggatggatcagtcacttatcatggcaat
ggggatggcacaattcatgtatataatgtgcctttacgctgggattccgctgatgatata
gaaaaaggcgtcatgcgggaagtgactgagagtatcataaaaaacagaaaaacagtgtac
gttgatacaggcgacgatgaaaaaatcaagcggctcattgatatcatgatgattcattaa

DBGET integrated database retrieval system