KEGG   Bacillus subtilis subsp. subtilis 168: BSU05230
Entry
BSU05230          CDS       T00010                                 

Symbol
ydeK
Name
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: EamA
Other DBs
NCBI-GeneID: 938112
NCBI-ProteinID: NP_388404
Pasteur: BG12138
BSORF: BG12138
UniProt: P96668 A0A6M3Z7W3
Position
complement(570371..571234)
AA seq 287 aa
MNKTTNGWINGFIGVLIFSGSLPATRLAVSDFDPLFLTVCRAAIAGVLAGGLLLIFRQQH
PAKRDLISLLVVAFGVVIGFPLLTALALQHVTSAHAIVFIGLLPLATAVFGVLRGGERPR
PVFWIFSAAGSLLVAGFALIQGGGSSPLGDAYMLASIVVCGLGYAEGAKLSRRLGNWQVI
SWALVLSLPLMLPLSFFFTPDSWSAIGVPALLSLAYVSLFSMLIGFVFWYRGLAQGGIAA
VGQLQLLQPFFGLLLASVILHEKVGWALVAVNIAVIMCVAAARRFAK
NT seq 864 nt   +upstreamnt  +downstreamnt
atgaacaaaacaacaaatggctggataaatggttttataggcgtactcattttcagcggc
tcgctgcctgcgacccgtttggctgtgtcagacttcgatccgttatttctcacagtttgc
cgtgctgcgatagctggtgtactggcgggaggtctccttctcatcttccggcagcagcat
cctgccaaaagagatctcatttcattgttagtggtagcgttcggcgtagtgattggtttc
ccgttgctgacagctttagcgcttcagcatgtcacatccgcacacgccattgtcttcatt
ggacttcttccactcgcaacggcagtcttcggcgtactgcgcgggggtgaacgccctcgc
cccgtcttctggattttctcagctgccggcagcttgttagtagcaggtttcgccctcatt
caggggggaggttcatccccgcttggcgacgcgtacatgctggcttctattgtcgtatgc
ggtcttggttatgcagaaggggccaaactttcacggcgtctggggaattggcaggtgatc
tcatgggcactcgttctgtcgcttcctcttatgctgccattgtcgttcttttttacgccg
gactcatggtcggcgatcggcgttcccgcactgctcagtcttgcatatgtatccttattc
agcatgctgattggcttcgtgttctggtatcgaggtcttgcccaagggggaattgcagcg
gttgggcagctccagcttctccagcctttttttggactgctgcttgcctcagtgattctg
cacgagaaagtgggctgggcactcgtagcagtgaatatcgccgttatcatgtgcgttgca
gcagctcggcgatttgcaaagtaa

DBGET integrated database retrieval system